DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RUG3

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_974971.2 Gene:RUG3 / 836208 AraportID:AT5G60870 Length:452 Species:Arabidopsis thaliana


Alignment Length:311 Identity:87/311 - (27%)
Similarity:131/311 - (42%) Gaps:82/311 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WRYAAL-AFGRKLCLRGLLD---DGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQ 106
            |.|... |.|.|:..|.|:.   |...:|       .|.|:|.:.:|...:.:||:||    ...
plant   176 WGYGGFGALGHKVYTRELVPRRVDDSWDC-------KISAIATSGTHTAAITESGELY----MWG 229

  Fly   107 AELVAVRLEAAP--RSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYS-------- 161
            .|....||...|  ..|.|...|:....||.:.|:.. ::||....:|::.|..:::        
plant   230 REEGDGRLGLGPGRGPNEGGGLSVPSKVKALTVPVAS-VSCGGFFTMALTKEGQLWNWGANSNYE 293

  Fly   162 --------------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELR 212
                          :||.      ...|:.|:.||..|::.|...|.|.:||:|..||||.:.||
plant   294 LGRGDNLGGWEPMPVPSL------EGVRITQIACGGYHSLALTEEGKVLSWGHGGHGQLGSSSLR 352

  Fly   213 VEETPQLLEALAGIKITQIAAGGWHSAAISAF-------GDLYTWGLNCSGQLGLRVMKPGGVLK 270
            .::.|..:||||..||..||:||..||||:.:       |:|:.||.....|||:    ||    
plant   353 NQKVPTEIEALADKKIVFIASGGSSSAAITGWDWFLTDGGELWMWGNAKDFQLGV----PG---- 409

  Fly   271 EPTVFPLPQLQDLPECACSQSGESN-----DDCAPLRVFA---GSRHTLLI 313
                  ||::|..|.       |.|     |:|.|.:|.:   |:.|.|.:
plant   410 ------LPEIQTTPV-------EVNFLTEEDECQPHKVISISIGASHALCL 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 78/275 (28%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 24/48 (50%)
RCC1_2 228..257 CDD:290274 13/35 (37%)
RUG3NP_974971.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.