DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RUG2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_199644.2 Gene:RUG2 / 834886 AraportID:AT5G48330 Length:455 Species:Arabidopsis thaliana


Alignment Length:338 Identity:87/338 - (25%)
Similarity:132/338 - (39%) Gaps:111/338 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 GDVDCAAGFSELNAPVSTQNQCT-----ISIGWRYA-ALAFGRKLCLRGLLDDG--PNECVTLEA 75
            |.:....|..|...|...:|...     :|:||.:| ||....|:...|.:.||  .|..:.|||
plant   168 GQLGLGNGIIEARVPSRVENLAAEHVVKVSLGWGHALALTVDGKVFGWGYVADGRVGNVGLPLEA 232

  Fly    76 T-------GNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAK 133
            :       |:::...||          |.|              .||||.:.             
plant   233 SLLDSITDGSMKGHHAA----------GDL--------------NLEAAEKK------------- 260

  Fly   134 APSSPIIEHIACGSHINVAISSENCVYSIP----SCLHQFSERQFRVKQLQCGHEHAVLLNANGD 194
                 ::|          |:|.||   .:|    .||.:.:..: :|..:.||.:|:::|..:|.
plant   261 -----VVE----------AMSKEN---DMPIAWEPCLVEETCNE-KVADIACGSDHSLILCHDGT 306

  Fly   195 VFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQ----IAAGGWHSAAISAFGD--LYTWGLN 253
            :.:.|:.:.||||.::..:...|        :.||:    ||||..||.||...|:  :.:||.|
plant   307 LLSAGSNIYGQLGRSKQDLGMKP--------VDITESPISIAAGLGHSLAICNRGERNILSWGWN 363

  Fly   254 CSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGR 318
            .|.|||..  ||               ::||.......|||     |..|.||..|:|.:...|.
plant   364 RSRQLGRG--KP---------------ENLPREVEGFDGES-----PASVSAGRVHSLCVTEKGE 406

  Fly   319 LWVSGWCKHGQLG 331
            .||.|..|:|:||
plant   407 AWVWGCGKNGRLG 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 67/264 (25%)
RCC1_2 176..205 CDD:290274 7/28 (25%)
RCC1 192..241 CDD:278826 15/52 (29%)
RCC1_2 228..257 CDD:290274 15/34 (44%)
RUG2NP_199644.2 ATS1 36..432 CDD:227511 87/338 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.