DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT5G16040

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_197108.1 Gene:AT5G16040 / 831461 AraportID:AT5G16040 Length:396 Species:Arabidopsis thaliana


Alignment Length:277 Identity:77/277 - (27%)
Similarity:113/277 - (40%) Gaps:73/277 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 IACGS----HINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLR 203
            ||.||    .:.:....|..:.|:...|..|:     |:.:..|..:::.:..:|.:||||...|
plant     8 IAWGSGEDGQLGLGTDEEKELASVVDALEPFN-----VRSVVGGSRNSLAICDDGKLFTWGWNQR 67

  Fly   204 GQLG-LAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLN-------------- 253
            |.|| ..|.:.|.||.|:::||.:||.|.|.||||..|:...|..|.||.|              
plant    68 GTLGHPPETKTESTPSLVKSLANVKIVQAAIGGWHCLAVDDQGRAYAWGGNEYGQCGEEPSKDET 132

  Fly   254 -------------CSGQLGLRVMKPGG-----VLKEPTVF----PLPQLQDLPECACSQSGESND 296
                         |:.||.:|.:..||     :.:|..|:    |.|            .|:...
plant   133 GRPVRRDIVIPKRCAQQLTVRQVAAGGTHSVVLTREGYVWTWGQPWP------------PGDIKQ 185

  Fly   297 DCAPLRV---------FAGSRHTLLIRRCGRLWVSGWCKHGQLGR-QLQDLSYVDAFQALEGITM 351
            ...|:||         ..|:.|.|.::..|.||..|..::||||. ..|..||....|.|:.:|:
plant   186 ISVPVRVQGLENVRLIAVGAFHNLALKEDGTLWAWGNNEYGQLGTGDTQPRSYPIPVQGLDDLTL 250

  Fly   352 NPTVDDVLCGPW-STLL 367
                .|:..|.| ||.|
plant   251 ----VDIAAGGWHSTAL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 77/277 (28%)
RCC1_2 176..205 CDD:290274 8/28 (29%)
RCC1 192..241 CDD:278826 24/49 (49%)
RCC1_2 228..257 CDD:290274 14/55 (25%)
AT5G16040NP_197108.1 ATS1 6..339 CDD:227511 77/277 (28%)
RCC1 320..385 CDD:395335
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.