DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT3G47660

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001325559.1 Gene:AT3G47660 / 823920 AraportID:AT3G47660 Length:990 Species:Arabidopsis thaliana


Alignment Length:283 Identity:72/283 - (25%)
Similarity:101/283 - (35%) Gaps:92/283 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LFT----GFNAFGQHECVSGDVDCAAGFSELNAP--VSTQNQC-TISIG---WRYAAL--AFGR- 55
            |||    .|.|.|..:.:|           .|.|  |...|.| ||...   |..||:  .||. 
plant   463 LFTFGDGTFGALGHGDRIS-----------TNIPREVEALNGCRTIKAACGVWHSAAVVSVFGEA 516

  Fly    56 ----KLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEA 116
                ||...|..|||              .|...|..|          |:.|....||       
plant   517 TSSGKLFTWGDGDDG--------------RLGHGDIEC----------RLIPSCVTEL------- 550

  Fly   117 APRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSI------------PSCLHQF 169
                               .:...:.:|||..|.||:|....||::            |||:...
plant   551 -------------------DTTSFQQVACGQSITVALSMSGQVYAMGTADPSHDIVRAPSCIEGG 596

  Fly   170 SERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAG 234
            ..:.| |:::.||..|..:||:..:|:|||.|..||||..:......|.|::||.|.::.::..|
plant   597 LGKSF-VQEVACGFHHIAVLNSKAEVYTWGKGSNGQLGHGDTEYRCMPTLVKALKGKQVRKVVCG 660

  Fly   235 GWHSAAISAFGDLY-TWGLNCSG 256
            ..::|.|.....:. |....|||
plant   661 SNYTATICLHKPITGTDSTKCSG 683

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 47/192 (24%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 16/48 (33%)
RCC1_2 228..257 CDD:290274 7/30 (23%)
AT3G47660NP_001325559.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.