DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT3G03790

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001189802.1 Gene:AT3G03790 / 821145 AraportID:AT3G03790 Length:1099 Species:Arabidopsis thaliana


Alignment Length:283 Identity:71/283 - (25%)
Similarity:114/283 - (40%) Gaps:61/283 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQP-KLQAELVAVRLEAAPRSNSGTKRSI 128
            ||.:...:|....:...||.|.    ||:.||..:.::. ||:..:..|         ||....:
plant    92 DGESGWSSLHRALHFGHLAVAS----VLIDSGASFTLEDIKLRTPVDLV---------SGPVAQV 143

  Fly   129 FGAAKAPSSPIIEHIACGSHINVAISSEN--------CVYSIPSCLHQFSERQFRVKQLQCGHEH 185
            .|  :..||...|..:.|:..|..:.:.|        .|.|:..|.         :|.:.....|
plant   144 IG--EQQSSVATEVFSWGNGANYQLGTGNQHVQKVPGRVDSLHGCF---------IKLVSAAKFH 197

  Fly   186 AVLLNANGDVFTWGNGLRGQLGLAELRVEE------TP-QLLEALAGIKITQIAAGGWHSAAISA 243
            :|.::.:|:|:|||.|..|:||..|..:..      || |::..|...::..:||...|:...:.
plant   198 SVAISTHGEVYTWGFGRGGRLGHPEFDIHSGQAAVITPRQVISGLGSRRVKAVAAAKHHTVIATE 262

  Fly   244 FGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSR 308
            .||:||||.|..||||               :.....|..|....|...:.      :.|.|.::
plant   263 GGDVYTWGSNREGQLG---------------YTSVDTQATPRKVTSLKAKI------VAVSAANK 306

  Fly   309 HTLLIRRCGRLWVSGWCKHGQLG 331
            ||.::..||.::..|..|.||||
plant   307 HTAVVSDCGEVFTWGCNKEGQLG 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 68/270 (25%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 17/55 (31%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
AT3G03790NP_001189802.1 ANK 29..137 CDD:238125 13/57 (23%)
Ank_2 29..126 CDD:289560 10/37 (27%)
ANK repeat 29..59 CDD:293786
ANK repeat 61..92 CDD:293786 71/283 (25%)
ANK repeat 95..126 CDD:293786 8/34 (24%)
RCC1 154..201 CDD:278826 10/55 (18%)
RCC1 205..259 CDD:278826 17/53 (32%)
RCC1 264..311 CDD:278826 18/67 (27%)
RCC1 315..365 CDD:278826 7/15 (47%)
SPOP_C_like 586..>615 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.