DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT3G15430

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001325716.1 Gene:AT3G15430 / 820782 AraportID:AT3G15430 Length:488 Species:Arabidopsis thaliana


Alignment Length:346 Identity:79/346 - (22%)
Similarity:129/346 - (37%) Gaps:95/346 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 STQNQCTISIGWRYAALAFGRKL--C---LRGLLDDG--PNECVTLEA-----TGNIRALAAADS 87
            ::|.:..|:.|..:..|....|:  |   |.|:|..|  ..:||....     ...:..::|..:
plant   109 TSQGKMQIATGKYHTLLINNSKVYSCGVSLSGVLAHGSETTQCVAFTPIEFPFPAQVAQVSATQN 173

  Fly    88 HCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNS-----GTKRSIF--GAAKAPSSPIIEHIAC 145
            |...:|||||:               |.....|:.     .|.|.||  ...:|......:.:|.
plant   174 HSAFVLQSGQV---------------LTCGDNSSHCCGHLDTSRPIFRPKLVEALKGTPCKQVAA 223

  Fly   146 GSHINVAISSENCVYSIPSCLH-----------------QFSERQFRVKQLQCGHEHAVLLNANG 193
            |.|..|.:|.|...|:..|..|                 :|.:....|.|:..|..:.:.:..:|
plant   224 GLHFTVFLSREGHAYTCGSNTHGQLGHGDTLDRPVPKVVEFLKTIGPVVQIAAGPSYVLAVTQDG 288

  Fly   194 DVFTWGNGLRGQLGLAELRVEETPQLLEAL--AGIKITQIAAGGWHSAAISAFGDLYTWGLNCSG 256
            .|:::|:|....||..|.:.|..|::::|.  .||.|.:::||..|:.|:.:.|.:||||....|
plant   289 SVYSFGSGSNFCLGHGEQQDELQPRVIQAFKRKGIHILRVSAGDEHAVALDSNGRVYTWGKGYCG 353

  Fly   257 QLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESND-----------DCAPLRVFAGSRHT 310
            .||                               .|:.||           :|..::|.|..|.|
plant   354 ALG-------------------------------HGDENDKITPQVLVNLNNCLAVQVCARKRKT 387

  Fly   311 LLIRRCGRLWVSGWCKHGQLG 331
            .::...|.|:..||...|.||
plant   388 FVLVEGGLLYGFGWMGFGSLG 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 67/291 (23%)
RCC1_2 176..205 CDD:290274 7/28 (25%)
RCC1 192..241 CDD:278826 16/50 (32%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
AT3G15430NP_001325716.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.