DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and rcbtb2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_005173422.1 Gene:rcbtb2 / 794652 ZFINID:ZDB-GENE-071016-3 Length:527 Species:Danio rerio


Alignment Length:328 Identity:75/328 - (22%)
Similarity:129/328 - (39%) Gaps:86/328 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVL--LQSGQLYRVQPK-----LQAELVAV 112
            |:.|:.|   ...||.:.:.....:.||....|.||.|  .||    .::|:     ...:::::
Zfish    22 RQACVFG---SAANEAIYVTVNDEVFALGTNCSGCLGLGDTQS----TIEPRRIDILCGKKIISL 79

  Fly   113 RLEAAP--------------------RSNSGTKRSIFGAAKAPSSPI---IEHIACGSHINVAIS 154
            .....|                    :..:||.......|...::.|   :..::||||..:|::
Zfish    80 SYGTGPHVVIATADGEVYAWGHNGYSQLGNGTTNHGLTPALVSTNLIGKRVTEVSCGSHHTIALT 144

  Fly   155 SENCVYS----------------------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFT 197
            ::..||:                      :.|||     :...|..:.||...::.:..||:.:.
Zfish   145 TDGEVYAWGYNNSGQVGSGSTANQPTPRRVSSCL-----QNKVVVNIACGQLCSMAVLDNGETYG 204

  Fly   198 WGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRV 262
            ||....|||||.....::||..:.||.||.|.|:|.|..|:.|::..|.:|:||.|..||||...
Zfish   205 WGYNCNGQLGLGNNGNQQTPCRIAALQGINIIQVACGYAHTLALTDEGFVYSWGANSYGQLGTGN 269

  Fly   263 MKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIR-RCGRLWVSGWCK 326
            .....|   ||:..:.:.:.:...||..|                 ||...: :.|::.:.|.|:
Zfish   270 KSNQAV---PTLINMDKERMVEVAACHTS-----------------HTSAAKTQSGQVLMWGQCR 314

  Fly   327 HGQ 329
             ||
Zfish   315 -GQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 70/305 (23%)
RCC1_2 176..205 CDD:290274 7/28 (25%)
RCC1 192..241 CDD:278826 20/48 (42%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
rcbtb2XP_005173422.1 RCC1 40..89 CDD:278826 10/52 (19%)
RCC1 93..143 CDD:278826 8/49 (16%)
RCC1 146..196 CDD:278826 8/54 (15%)
RCC1 199..248 CDD:278826 20/48 (42%)
RCC1 251..299 CDD:278826 17/67 (25%)
BTB 364..460 CDD:279045
BTB 371..463 CDD:197585
SPOP_C_like 463..521 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.