DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and AT4G14368

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001154232.2 Gene:AT4G14368 / 7922506 AraportID:AT4G14368 Length:1106 Species:Arabidopsis thaliana


Alignment Length:297 Identity:64/297 - (21%)
Similarity:114/297 - (38%) Gaps:76/297 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 NIRALAAADSHCLVLLQSGQLY--------RVQPKLQAELVAVRL-EAAPRSNSGTKRSIFGAAK 133
            ::..:|....|..::.:.|:::        |:...:|.::...:| |....:|            
plant   271 DVHQIACGVRHIALVTRQGEVFTWEEEAGGRLGHGIQVDVCRPKLVEFLALTN------------ 323

  Fly   134 APSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFS-------------------ERQFRVKQL 179
                  |:.:|||.:...|:|:...:::....:|...                   ....:|..:
plant   324 ------IDFVACGEYHTCAVSTSGDLFTWGDGIHNVGLLGHGSDLSHWIPKRVSGPVEGLQVLSV 382

  Fly   180 QCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAI--- 241
            .||..|:.|..|||.:||:|:|..|.||..:......|:.::.|:|:|..::|.|.||:.||   
plant   383 ACGTWHSALATANGKLFTFGDGAFGVLGHGDRESVSYPKEVKMLSGLKTLKVACGVWHTVAIVEV 447

  Fly   242 -------SAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCA 299
                   ::...|:|||.....:||     .|.  ||..:        ||.|..|....:.:..|
plant   448 MNQTGTSTSSRKLFTWGDGDKNRLG-----HGN--KETYL--------LPTCVSSLIDYNFNQIA 497

  Fly   300 PLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQD 336
                 .|...|:.:...|.::..|...|||||....|
plant   498 -----CGHTFTVALTTSGHVFTMGGTSHGQLGSSNSD 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 64/297 (22%)
RCC1_2 176..205 CDD:290274 12/28 (43%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 10/38 (26%)
AT4G14368NP_001154232.2 PH_PLC_plant-like 17..128 CDD:270171
RCC1 289..337 CDD:278826 10/65 (15%)
RCC1 340..391 CDD:278826 5/50 (10%)
RCC1 395..444 CDD:278826 17/48 (35%)
RCC1 459..506 CDD:278826 16/66 (24%)
RCC1 509..558 CDD:278826 8/21 (38%)
RCC1 563..607 CDD:278826
FYVE 613..680 CDD:214499
DASH_Spc19 <812..885 CDD:285487
BRX_N 853..887 CDD:290432
BRX 964..>994 CDD:285568
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.