DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and hectd3

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001072497.1 Gene:hectd3 / 779952 XenbaseID:XB-GENE-5937967 Length:845 Species:Xenopus tropicalis


Alignment Length:355 Identity:75/355 - (21%)
Similarity:111/355 - (31%) Gaps:135/355 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EC---VSGDVDCAAGFSELNAPVS-------------------TQNQCTIS-------------- 43
            ||   ..|.:|...||.:..|.:|                   |.||...:              
 Frog   513 ECKFIAEGIIDQGGGFRDSLADISEELCPSSADIPVPLPFFVRTSNQGNGTGEAQDMYVPNPSCK 577

  Fly    44 -------IGWRYAALAFGRK---LCLRGLLDDGPNECVTLEATGN----IRALAAADSHCLVLLQ 94
                   ||....|...|::   |.|.||        |..:.||.    .:...|.||..:.||:
 Frog   578 DLAKYEWIGQLMGAALRGKEFLVLALPGL--------VWKQLTGEEVSWSKDFPAVDSLLVKLLE 634

  Fly    95 SGQLYRVQP---KLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSE 156
            ..:|...:.   |...||              |..::....|     ::|.:..||:|:|.....
 Frog   635 MMELMDEETFEFKFSGEL--------------TYTTVLSDQK-----MVELVPGGSNISVLYKDR 680

  Fly   157 -NCVYSIPSCLHQFSERQFRVKQLQCG----HEHAVLLNANGDVFTWGNGLRGQLGLAELRVEET 216
             ..:..:...  :..|.:.::..||.|    ...|||     |:.||..        .|.||...
 Frog   681 VEFIRMVQKA--RLEESKEQIGALQAGLLKVVPQAVL-----DLLTWQE--------LEKRVCGD 730

  Fly   217 PQL-LEALAGIKITQIAAGGWHSAAISAFGDL--------YTWG-----LNCSGQLGLRVMKPGG 267
            |:: :|||.  |:|:             |||:        |.|.     .|......||.:....
 Frog   731 PEITVEALK--KLTR-------------FGDIEQTDTRVQYFWEALNNFTNEDRSRFLRFVTGRS 780

  Fly   268 VLKEPT-VFP----LPQLQDLPECA-CSQS 291
            .|..|. ::|    |.....|||.: ||.|
 Frog   781 RLPAPIYIYPDRSWLGTDDSLPESSTCSSS 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 53/246 (22%)
RCC1_2 176..205 CDD:290274 9/32 (28%)
RCC1 192..241 CDD:278826 12/49 (24%)
RCC1_2 228..257 CDD:290274 7/41 (17%)
hectd3NP_001072497.1 APC10-HECTD3 222..355 CDD:176487
HECTc 512..837 CDD:421431 75/355 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.