DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcbtb1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001347539.1 Gene:Rcbtb1 / 71330 MGIID:1918580 Length:531 Species:Mus musculus


Alignment Length:351 Identity:78/351 - (22%)
Similarity:128/351 - (36%) Gaps:103/351 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 CAAGFSELNAPVSTQNQCTISIGWRYAALAFGRKLCLRGLLDDGPNECV----TLEAT--GNIRA 81
            |..|.|...|...|.|......|..|:           ..|..|.|:..    .|||.  ..|::
Mouse    25 CVFGTSANEAIYVTDNDEVFVFGLNYS-----------NCLGTGDNQSTLVPKKLEALCGKKIKS 78

  Fly    82 LA-AADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIE---H 142
            |: .:..|.|:..:.|.:|.......::|           .:||........:..::.:|:   .
Mouse    79 LSYGSGPHVLLTTEDGVVYAWGHNGYSQL-----------GNGTTNQGIAPVQVCTNLLIKQVIE 132

  Fly   143 IACGSHINVAISSE---------NC-------------VYSIPSCLHQFSERQFRVKQLQCGHEH 185
            :|||||.::|::::         ||             ...:.:|||     ..||..:.||...
Mouse   133 VACGSHHSMALAADGELFAWGYNNCGQVGSGSTANQPTPRKVTNCLH-----TKRVVNIACGQTS 192

  Fly   186 AVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTW 250
            ::.:..:|:|:.||....|||||.....:.||..:.||.|:.:.||..|..|:.|::..|.||.|
Mouse   193 SMAVLDSGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHGMCVNQIVCGYAHTLALTDEGLLYAW 257

  Fly   251 GLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRR 315
            |.|..||||                               :|..|:..:|.::.......:.|..
Mouse   258 GANTYGQLG-------------------------------TGSKNNLLSPTQIMVEKERVIEIAA 291

  Fly   316 C------------GRLWVSGWCKHGQ 329
            |            |.:::.|.|: ||
Mouse   292 CHSTHTSAAKTQGGHVYMWGQCR-GQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 64/290 (22%)
RCC1_2 176..205 CDD:290274 7/28 (25%)
RCC1 192..241 CDD:278826 18/48 (38%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
Rcbtb1NP_001347539.1 RCC1 1 40..91 13/61 (21%)
ATS1 43..>316 CDD:227511 70/331 (21%)
RCC1 2 93..145 12/62 (19%)
RCC1 3 147..198 9/55 (16%)
RCC1 4 199..250 19/50 (38%)
RCC1 5 252..302 15/80 (19%)
RCC1 6 304..356 5/14 (36%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.