DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcc1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006239135.1 Gene:Rcc1 / 682908 RGDID:1592835 Length:434 Species:Rattus norvegicus


Alignment Length:243 Identity:60/243 - (24%)
Similarity:94/243 - (38%) Gaps:52/243 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 GTKRSIFGAAKAPSSPIIEHI----ACGSHINVAISSENCVYS--------------------IP 163
            |...|:....|....|:::.:    |.|.| .|.:|....|||                    :|
  Rat    62 GLGESVLERKKPALVPLLQDVVQAEAGGMH-TVCLSQSGQVYSFGCNDEGALGRDTSVEGSEMVP 125

  Fly   164 SCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGN--GLRGQLGLAE-LRVEETPQLLEALAG 225
            ..:    |.|.:|.|:..|..|...|..:|.||.||:  ...|.:||.| ::....|  ::....
  Rat   126 GKV----ELQEKVVQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLLEPMKKSMVP--VQVQLD 184

  Fly   226 IKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFP-------LPQLQDL 283
            .::.::|:|..|...::..|||||.|....||||          :.|.:|.       |.:|. :
  Rat   185 TQVVKVASGNDHLVMLTTDGDLYTLGCGEQGQLG----------RVPELFANRGGRQGLERLL-V 238

  Fly   284 PECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLG 331
            |.|...:|..:.........|.|:..|..|.|.|.::..|...:.|||
  Rat   239 PRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLG 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 60/243 (25%)
RCC1_2 176..205 CDD:290274 10/30 (33%)
RCC1 192..241 CDD:278826 13/51 (25%)
RCC1_2 228..257 CDD:290274 9/28 (32%)
Rcc1XP_006239135.1 ATS1 19..432 CDD:227511 60/243 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.