Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017211386.1 | Gene: | herc5.1 / 559981 | ZFINID: | ZDB-GENE-090311-56 | Length: | 884 | Species: | Danio rerio |
Alignment Length: | 206 | Identity: | 59/206 - (28%) |
---|---|---|---|
Similarity: | 87/206 - (42%) | Gaps: | 48/206 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 RVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL-AELRVEETPQLLEALAGIKITQIAAGGWHS 238
Fly 239 AAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAP--- 300
Fly 301 --------LRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQ-ALEGITMNPTVD 356
Fly 357 DVLCGPWSTLL 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 59/206 (29%) |
RCC1_2 | 176..205 | CDD:290274 | 10/28 (36%) | ||
RCC1 | 192..241 | CDD:278826 | 22/49 (45%) | ||
RCC1_2 | 228..257 | CDD:290274 | 12/28 (43%) | ||
herc5.1 | XP_017211386.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |