DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and herc5.1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_017211386.1 Gene:herc5.1 / 559981 ZFINID:ZDB-GENE-090311-56 Length:884 Species:Danio rerio


Alignment Length:206 Identity:59/206 - (28%)
Similarity:87/206 - (42%) Gaps:48/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL-AELRVEETPQLLEALAGIKITQIAAGGWHS 238
            :|.|:.||.:|::.|..:|.:|.||....||||| .|....::|:.|::|.||.:.||:|||.||
Zfish    11 QVIQIACGDQHSMALTNDGQLFVWGENALGQLGLRKEQAGTQSPRHLQSLCGIPVAQISAGGNHS 75

  Fly   239 AAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAP--- 300
            ..:|..|.::.||.|.:|||||                               |::.|...|   
Zfish    76 FVLSLSGVVFGWGGNSAGQLGL-------------------------------GDTTDRFVPTVV 109

  Fly   301 --------LRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQ-ALEGITMNPTVD 356
                    :.:..|..||..:.:.|.::..|....||||..    |:.|... .|........|.
Zfish   110 NSLKRKKIVSISCGGEHTAALAKGGTVFTFGSGGFGQLGHN----SFKDEHHPRLVAELWGSKVS 170

  Fly   357 DVLCGPWSTLL 367
            .|.||...||:
Zfish   171 QVTCGRNHTLV 181

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 59/206 (29%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 22/49 (45%)
RCC1_2 228..257 CDD:290274 12/28 (43%)
herc5.1XP_017211386.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.