DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and herc2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_021332870.1 Gene:herc2 / 558479 ZFINID:ZDB-GENE-070718-6 Length:4831 Species:Danio rerio


Alignment Length:279 Identity:68/279 - (24%)
Similarity:105/279 - (37%) Gaps:85/279 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   116 AAPRSNSGTKRSIFG----------------AAKAPSSPIIEHIACGSHINVAISSENCVYS--- 161
            ::|.||.||.:.:.|                ..||.|:..:..|.|.....:.::....||:   
Zfish   403 SSPTSNKGTLQEVIGWGLLGWKPYANVNGPIQCKALSNLGVTQIVCSEKGFLILTITGAVYTQNY 467

  Fly   162 -----IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLE 221
                 .|..:|..:.|:..........:|.:.|:.||:||:||.|..|:||..:....|.|.::.
Zfish   468 KSTTLAPMLVHALTSRKIMKLAAHPDGQHYLALSVNGEVFSWGCGDGGRLGHGDTTYLEEPTMIS 532

  Fly   222 ALA----GIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQD 282
            ..:    |.::..||.|..:||||:|.|:|:|||....|:||                       
Zfish   533 VFSGRPVGKQVVHIACGSTYSAAITADGELHTWGRGNYGRLG----------------------- 574

  Fly   283 LPECACSQSGESNDDCAPLRVFA-------------GSRHTLLIRRCGRLWVSGWCKHGQLGR-- 332
                    .|.|.|...|:.|.|             |...||.:...|::|..|...:|:|||  
Zfish   575 --------HGSSEDQTTPMLVTALKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGG 631

  Fly   333 -----------QLQDLSYV 340
                       :||||..|
Zfish   632 SDGCKTPKLVEKLQDLDIV 650

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 68/279 (24%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 18/52 (35%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
herc2XP_021332870.1 RCC1 <483..772 CDD:332518 53/199 (27%)
Cyt-b5 1204..1276 CDD:306642
MIB_HERC2 1862..1920 CDD:310955
UBA_HERC2 2453..2499 CDD:270585
Cul7 2548..2625 CDD:314424
ZZ_HERC2 2700..2744 CDD:239084
APC10-HERC2 2759..2902 CDD:176485
RCC1 2946..3316 CDD:332518
RCC1 4020..4325 CDD:332518
HECTc 4418..4789 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.