DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and rcc1l

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001076272.1 Gene:rcc1l / 555972 ZFINID:ZDB-GENE-060526-370 Length:451 Species:Danio rerio


Alignment Length:314 Identity:79/314 - (25%)
Similarity:109/314 - (34%) Gaps:86/314 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 LEAAPRS----NSGTKRSIFGAAKAPSSPIIEHIACG-SHINVAISSE-----------NC---- 158
            |||:|.|    |             |....:..::|| :|..|...||           .|    
Zfish   146 LEASPVSLPLLN-------------PQETRVPQVSCGRAHSLVLTDSEGVFSMGSNTFGQCGRKI 197

  Fly   159 ----VYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQL 219
                |||....:|:......||.|:.||.:|::.|...|.||..|.|..||.||........|..
Zfish   198 VEDEVYSGSHVVHKIEGFDSRVIQVACGQDHSLFLTDRGSVFACGWGADGQTGLGHHNKASCPVP 262

  Fly   220 LEA-LAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDL 283
            :.. |||:.:.|:|..|..|.|:|..|.::.||  .|..|.|..:.....:..|.:.||..:..:
Zfish   263 VGGDLAGVTVQQVATYGDCSLAVSTDGQVFGWG--NSEYLQLASVTESTQISSPRLLPLKGVGRI 325

  Fly   284 PECAC--SQSGESNDD--------------------CAPLRVFA-------------------GS 307
            .:.||  :|....|:|                    ..|.||.|                   |.
Zfish   326 RQAACGGTQVAVLNEDGDVFVWGFGILGKGPKLSESAIPERVPATFFGRSEFNPTVKVASIRCGL 390

  Fly   308 RHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALEGITMNPTVDDVLCG 361
            .|...:...|.|:|.|....|.||....|..|..     ..:|:...|.||.||
Zfish   391 SHFAAVTDGGELFVWGKNVRGCLGIGKHDDQYFP-----WRVTVPGHVTDVACG 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 79/314 (25%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 17/49 (35%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
rcc1lNP_001076272.1 RCC1 52..108 CDD:278826
RCC1_2 165..192 CDD:290274 6/26 (23%)
RCC1 182..232 CDD:278826 11/49 (22%)
RCC1_2 219..248 CDD:290274 11/28 (39%)
RCC1 236..285 CDD:278826 17/48 (35%)
RCC1 288..338 CDD:278826 12/51 (24%)
RCC1_2 383..412 CDD:290274 6/28 (21%)
RCC1 400..446 CDD:278826 15/45 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.