DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RCBTB1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001339429.1 Gene:RCBTB1 / 55213 HGNCID:18243 Length:531 Species:Homo sapiens


Alignment Length:364 Identity:79/364 - (21%)
Similarity:130/364 - (35%) Gaps:99/364 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FNAFGQHECVSGDVDCAAGFSELNAPVSTQNQCTISIGWRYAALAFGRKLCLRGLLDDGPNECVT 72
            |......|..|....|..|.|...|...|.|......|..|:.       ||.  ..|..:..|.
Human    10 FTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSN-------CLG--TGDNQSTLVP 65

  Fly    73 LEATG----NIRALA-AADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAA 132
            .:..|    .|::|: .:..|.|:..:.|.:|.......::|           .:||........
Human    66 KKLEGLCGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQL-----------GNGTTNQGIAPV 119

  Fly   133 KAPSSPIIE---HIACGSHINVAISSENCVYS----------------------IPSCLHQFSER 172
            :..::.:|:   .:|||||.::|::::..|::                      :.:|||     
Human   120 QVCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLH----- 179

  Fly   173 QFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWH 237
            ..||..:.||...::.:..||:|:.||....|||||.....:.||..:.||..:.:.||..|..|
Human   180 IKRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVCGYAH 244

  Fly   238 SAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLR 302
            :.|::..|.||.||.|..||||                               :|..|:..:|..
Human   245 TLALTDEGLLYAWGANTYGQLG-------------------------------TGNKNNLLSPAH 278

  Fly   303 VFAGSRHTLLIRRC------------GRLWVSGWCKHGQ 329
            :.......:.|..|            |.:::.|.|: ||
Human   279 IMVEKERVVEIAACHSAHTSAAKTQGGHVYMWGQCR-GQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 63/290 (22%)
RCC1_2 176..205 CDD:290274 8/28 (29%)
RCC1 192..241 CDD:278826 18/48 (38%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
RCBTB1NP_001339429.1 RCC1 1 40..91 12/59 (20%)
ATS1 43..>316 CDD:227511 68/329 (21%)
RCC1 2 93..145 12/62 (19%)
RCC1 3 147..198 8/55 (15%)
RCC1 4 199..250 19/50 (38%)
RCC1 5 252..302 15/80 (19%)
RCC1 6 304..356 5/14 (36%)
BTB_POZ_RCBTB1_CLLD7 350..466 CDD:349662
BACK_RCBTB1 466..531 CDD:350603
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.