DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HERC6

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_005263140.1 Gene:HERC6 / 55008 HGNCID:26072 Length:1034 Species:Homo sapiens


Alignment Length:328 Identity:80/328 - (24%)
Similarity:135/328 - (41%) Gaps:76/328 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 AAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRS----IFGAAKA--PSSP--- 138
            |:.:.|.|:||.:.::.......:.:|          ...|.:|.    :.|....  |..|   
Human    29 ASGERHSLLLLTNHRVLSCGDNSRGQL----------GRRGAQRGELPVVVGGCFVLFPKEPIQA 83

  Fly   139 ----IIEHIACGSHINVAISSENCVYSIPS------CLHQFSERQF-----------RVKQLQCG 182
                |::.::||...::|:..:..|::..:      .:.:|.|..|           ::.|:.||
Human    84 LETLIVDLVSCGKEHSLAVCHKGRVFAWGAGSEGQLGIGEFKEISFTPKKIMTLNDIKIIQVSCG 148

  Fly   183 HEHAVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGD 246
            |.|::.|:.:..||:||....|||||. |...:.:||.:.:|.||.:.|:||||.||.|:|..|.
Human   149 HYHSLALSKDSQVFSWGKNSHGQLGLGKEFPSQASPQRVRSLEGIPLAQVAAGGAHSFALSLCGT 213

  Fly   247 LYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTL 311
            .:.||.|.:|||.|....          .|:...:.|...|....|.....|       |..||.
Human   214 SFGWGSNSAGQLALSGRN----------VPVQSNKPLSVGALKNLGVVYISC-------GDAHTA 261

  Fly   312 LIRRCGRLWVSGWCKHGQLG-------RQLQDLSYVDAFQALEGITMNPTVDDVLCGPWSTLLHL 369
            ::.:.|:::..|..:.||||       |..|.:..:|..           |..:.||.:.||.::
Human   262 VLTQDGKVFTFGDNRSGQLGYSPTPEKRGPQLVERIDGL-----------VSQIDCGSYHTLAYV 315

  Fly   370 KCT 372
            ..|
Human   316 HTT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 79/325 (24%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 22/49 (45%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
HERC6XP_005263140.1 RCC1_2 27..54 CDD:290274 5/24 (21%)
RCC1_2 89..118 CDD:290274 4/28 (14%)
RCC1 105..155 CDD:278826 9/49 (18%)
RCC1 158..208 CDD:278826 22/49 (45%)
RCC1 215..263 CDD:278826 15/64 (23%)
RCC1_2 250..279 CDD:290274 6/35 (17%)
RCC1 266..313 CDD:278826 13/57 (23%)
HECTc 684..1026 CDD:238033
HECTc 711..1026 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.