DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HERC5

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_011530324.2 Gene:HERC5 / 51191 HGNCID:24368 Length:1100 Species:Homo sapiens


Alignment Length:302 Identity:82/302 - (27%)
Similarity:128/302 - (42%) Gaps:57/302 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 LQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTK----RSIFGAAKAP------SSPIIEHIACGS 147
            |....|.||:...|......||....|..:|.:    .:..|.|:.|      .:..|..:..|:
Human   193 LHRALLRRVEVTRQLCCSPGRLAVLERGGAGVQVHQLLAGSGGARTPKCIKLGKNMKIHSVDQGA 257

  Fly   148 HINVAISS-----ENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLG 207
            ...:.:||     |...||:.....:...::.::.|:.||..|::.|:..|::|.||..|.||||
Human   258 EHMLILSSDGKPFEYDNYSMKHLRFESILQEKKIIQITCGDYHSLALSKGGELFAWGQNLHGQLG 322

  Fly   208 LA-ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKE 271
            :. :.....|||::|.|||:.:.||:||..||.|:|..|::|:||.|..|||||           
Human   323 VGRKFPSTTTPQIVEHLAGVPLAQISAGEAHSMALSMSGNIYSWGKNECGQLGL----------- 376

  Fly   272 PTVFPLPQLQDLPECACSQSGESNDDCAPLR---------VFAGSRHTLLIRRCGRLWVSGWCKH 327
                              ...||.||.:.:.         |..|..|:.|:.:.|.|:..|..||
Human   377 ------------------GHTESKDDPSLIEGLDNQKVEFVACGGSHSALLTQDGLLFTFGAGKH 423

  Fly   328 GQLGRQLQDLSYVDAFQALEGITMNPTVDDVLCGPWSTLLHL 369
            ||||   .:.:..:....|....:...|..:.||.|.||.::
Human   424 GQLG---HNSTQNELRPCLVAELVGYRVTQIACGRWHTLAYV 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 82/302 (27%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 22/49 (45%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
HERC5XP_011530324.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.