DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and rcc1l

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001007510.1 Gene:rcc1l / 493236 XenbaseID:XB-GENE-963910 Length:449 Species:Xenopus tropicalis


Alignment Length:288 Identity:70/288 - (24%)
Similarity:102/288 - (35%) Gaps:67/288 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PSSPIIEHIACG-SHINVAISSE-----------NC--------VYSIPSCLHQFSERQFRVKQL 179
            |....:..::|| :|..:....|           .|        :||....:|:..|...||.|:
 Frog   156 PQETKVLQVSCGRAHSLILTDKEGVFSLGNNSYGQCAREVIEGEIYSESQLIHRVRELDSRVVQV 220

  Fly   180 QCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEA-LAGIKITQIAAGGWHSAAISA 243
            .||.:|::.....|:|::.|.|..||.||....|...|..|.. :||:.|.|:|..|....|:|.
 Frog   221 ACGQDHSLFRTEKGEVYSCGWGADGQTGLGHFNVCSNPTKLGGDMAGVNIVQVATYGDCCLAVSE 285

  Fly   244 FGDLYTWG--------------------------------LNCSGQLGLRVMKPGGVL------- 269
            .|.||.||                                :.|.|...:.|...|.|.       
 Frog   286 EGQLYGWGNSEYLQLACVTDSTQVNVPQHLPFQHVGKVKHVACGGTGCIAVNGDGSVFVWGYGIL 350

  Fly   270 -KEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQ 333
             |.|......|.:.:|:.....| :.|.|....:||:|..|...:...|.|:|.|....|.||..
 Frog   351 GKGPNFLEAQQPEIIPQSLFGLS-DFNPDIRVTKVFSGLGHFAALNNRGELFVWGKNLRGCLGTG 414

  Fly   334 LQDLSYVDAFQALEGITMNPTVDDVLCG 361
            ..:..|..     ..:|:...|.||.||
 Frog   415 RFEDQYFP-----WRVTVPGEVVDVSCG 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 70/288 (24%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 17/49 (35%)
RCC1_2 228..257 CDD:290274 12/60 (20%)
rcc1lNP_001007510.1 RCC1 <51..374 CDD:332518 50/218 (23%)
RCC1_2 381..410 CDD:316098 8/28 (29%)
RCC1 398..444 CDD:306840 14/45 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.