DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and nek8

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_012812229.1 Gene:nek8 / 448753 XenbaseID:XB-GENE-990378 Length:698 Species:Xenopus tropicalis


Alignment Length:320 Identity:79/320 - (24%)
Similarity:118/320 - (36%) Gaps:88/320 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PKLQAELVAV---RLEAAPRSNSGTKRSIFGAAK-----APSSP-IIEHIACGSHINVAISSENC 158
            |.|..|:|.|   |.:.|..:.||  |.|...|.     |||.| .|||                
 Frog   336 PMLNTEVVQVSAGRTQKAGVTKSG--RLIMWEATPVGTGAPSLPGSIEH---------------- 382

  Fly   159 VYSIPSCLHQFSERQ--FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLE 221
              :.|..:.:|.|.|  ..:|.:.||......|...|.:.|:|:|..|.||.|.......|:::|
 Frog   383 --AQPQFISRFLEGQSGVTIKHVSCGDLFTACLTDRGIIMTFGSGSNGCLGHANFNDVTQPKIVE 445

  Fly   222 ALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPEC 286
            .|.|.:|..::.|..|:.|:|...::::||...:|:|||...:.   ...|....:|...:....
 Frog   446 DLLGYEIVHVSCGASHAIAVSNEKEVFSWGRGDNGRLGLGSQES---YNSPQQVIIPPEYEAQRV 507

  Fly   287 AC-------------------------------SQSGESNDD------------CAPLRVFA--- 305
            .|                               |.|..|::|            .|||...|   
 Frog   508 VCGIDSSMILTVANQLLACGSNRFNKLGFDRILSASEPSSEDQVEEAYTFTPIQSAPLNQEAILC 572

  Fly   306 ---GSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAF-QALEGITMNPTVDDVLCG 361
               |:.|:.::...|:.:..|..:|||||......|.|... .||:|:    .|..|.||
 Frog   573 ADVGTSHSAVVTALGQCYTFGSNQHGQLGTSAHRNSRVPCLVSALQGV----KVTMVACG 628

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 79/320 (25%)
RCC1_2 176..205 CDD:290274 8/28 (29%)
RCC1 192..241 CDD:278826 15/48 (31%)
RCC1_2 228..257 CDD:290274 7/28 (25%)
nek8XP_012812229.1 STKc_Nek8 3..258 CDD:270859
S_TKc 4..256 CDD:214567
ATS1 320..657 CDD:227511 79/320 (25%)
RCC1 421..465 CDD:278826 14/43 (33%)
RCC1 470..517 CDD:278826 9/49 (18%)
RCC1 587..635 CDD:278826 16/46 (35%)
RCC1 638..687 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.