Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_998343.1 | Gene: | rcc1 / 406457 | ZFINID: | ZDB-GENE-040426-2216 | Length: | 418 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 57/204 - (27%) |
---|---|---|---|
Similarity: | 95/204 - (46%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 176 VKQLQCGHEHAVLLNANGDVFTWGNGLRGQLG--LAELRVEETPQLLEALAGIKITQIAAGGWHS 238
Fly 239 AAISAFGDLYTWG--LNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPL 301
Fly 302 RVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQAL------EGITMNP----TVD 356
Fly 357 DVLCGPWST 365 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 57/204 (28%) |
RCC1_2 | 176..205 | CDD:290274 | 9/28 (32%) | ||
RCC1 | 192..241 | CDD:278826 | 19/50 (38%) | ||
RCC1_2 | 228..257 | CDD:290274 | 12/30 (40%) | ||
rcc1 | NP_998343.1 | ATS1 | 3..415 | CDD:227511 | 57/204 (28%) |
RCC1 | 34..82 | CDD:278826 | 4/12 (33%) | ||
RCC1 | 86..134 | CDD:278826 | 19/49 (39%) | ||
RCC1 | 137..187 | CDD:278826 | 16/70 (23%) | ||
RCC1 | 191..252 | CDD:278826 | 16/59 (27%) | ||
RCC1 | 255..306 | CDD:278826 | |||
RCC1 | 309..357 | CDD:278826 | |||
RCC1 | 361..411 | CDD:278826 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |