DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and rcc1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_998343.1 Gene:rcc1 / 406457 ZFINID:ZDB-GENE-040426-2216 Length:418 Species:Danio rerio


Alignment Length:204 Identity:57/204 - (27%)
Similarity:95/204 - (46%) Gaps:37/204 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 VKQLQCGHEHAVLLNANGDVFTWGNGLRGQLG--LAELRVEETPQLLEALAGIKITQIAAGGWHS 238
            :.|...|..|.|.|:..|:|:|:|....|.||  .:|...|..|..::  .|.||.|::||..||
Zfish    69 IVQAVAGGMHTVCLSDTGNVYTFGCNDEGALGRDTSEEGSETVPAKVD--LGEKIIQVSAGDSHS 131

  Fly   239 AAISAFGDLYTWG--LNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPL 301
            ||::..|.:|.||  .:.:|.:||  ::|   :|:.|| |:....|.|               .:
Zfish   132 AALTEDGGVYVWGSFRDNNGVIGL--LEP---MKKCTV-PVKVPIDKP---------------VV 175

  Fly   302 RVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQAL------EGITMNP----TVD 356
            ::.:|:.|.:::...|.|:.||..:.|||||..:..:.....:.|      :.:.:.|    ...
Zfish   176 KIVSGNDHLVMLTAHGELYTSGCGEQGQLGRVAEHFANRGGRKGLMRLLEPQMVIIKPRGKVVFT 240

  Fly   357 DVLCGPWST 365
            ||.||.:.|
Zfish   241 DVFCGAYFT 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 57/204 (28%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 19/50 (38%)
RCC1_2 228..257 CDD:290274 12/30 (40%)
rcc1NP_998343.1 ATS1 3..415 CDD:227511 57/204 (28%)
RCC1 34..82 CDD:278826 4/12 (33%)
RCC1 86..134 CDD:278826 19/49 (39%)
RCC1 137..187 CDD:278826 16/70 (23%)
RCC1 191..252 CDD:278826 16/59 (27%)
RCC1 255..306 CDD:278826
RCC1 309..357 CDD:278826
RCC1 361..411 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.