DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Herc4

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001261249.1 Gene:Herc4 / 38151 FlyBaseID:FBgn0035207 Length:1062 Species:Drosophila melanogaster


Alignment Length:344 Identity:87/344 - (25%)
Similarity:139/344 - (40%) Gaps:86/344 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKR---SIFGAAKAPSSPII 140
            ::.:|....|.|.|..:|::|.......::|         ..:..|||   |.|.........:|
  Fly    42 VQQVACGHRHTLFLTATGKVYACGSNDYSQL---------GHDLPTKRPRMSPFLLIPELQDYVI 97

  Fly   141 EHIACGSHINVAIS---------SENC----------VYSIPSCLHQFSERQFRVKQLQCGHEHA 186
            ..|.|||..::|:|         ..:|          :..:|..:.|...:  .|.|:.||:.|:
  Fly    98 IQICCGSRHSLALSDWGQVLSWGDNDCGQLGHATDKEIVQLPKVVRQLVTK--TVVQIACGNNHS 160

  Fly   187 VLLNANGDVFTWGNGLRGQLGL---AELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLY 248
            :.|.:.|::::||:.:.||||:   .:|.....|..|..|.||.:..||.||.||..||..|.::
  Fly   161 LALTSCGELYSWGSNIYGQLGVNSPNDLTHCNYPLRLTTLLGIPLAAIACGGNHSFLISKSGAVF 225

  Fly   249 TWGLNCSGQLG------------LRVMKPGGVL-----KEPTVFPLPQLQDLPECACSQSGE--- 293
            .||.|..||||            |:.::..||.     .|.:|| |.....:..|.....|:   
  Fly   226 GWGRNNCGQLGLNDETNRSYPTQLKTLRTLGVRFVACGDEFSVF-LTNEGGVFTCGAGAYGQLGH 289

  Fly   294 --SNDDCAP-----------LRVFAGSRHTL-LIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQ 344
              |:::..|           .:|..|:|||| |:...||::..|....||||.:           
  Fly   290 GFSSNEMLPRMVMELMGSTITQVACGNRHTLALVPSRGRVYAFGLGSSGQLGTR----------- 343

  Fly   345 ALEGITMNPTVDDVLCGPW 363
                .|.:..:..|:.|||
  Fly   344 ----STKSLMLPQVVIGPW 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 87/344 (25%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 19/51 (37%)
RCC1_2 228..257 CDD:290274 12/28 (43%)
Herc4NP_001261249.1 RCC1 6..55 CDD:278826 3/12 (25%)
RCC1 59..110 CDD:278826 13/59 (22%)
RCC1 114..163 CDD:278826 8/50 (16%)
RCC1 167..218 CDD:278826 19/50 (38%)
RCC1 221..270 CDD:278826 14/49 (29%)
RCC1 273..322 CDD:278826 10/48 (21%)
RCC1_2 309..339 CDD:290274 10/29 (34%)
RCC1 327..390 CDD:278826 12/47 (26%)
HECTc 715..1060 CDD:238033
HECTc 739..1059 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.