DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Herc6

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_008761185.1 Gene:Herc6 / 362376 RGDID:1561739 Length:1027 Species:Rattus norvegicus


Alignment Length:333 Identity:89/333 - (26%)
Similarity:148/333 - (44%) Gaps:76/333 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 LEATGNIRALAAA--DSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAP 135
            |||...::.|.||  :.|.|:|..:.::|......:.:|       ..:|...|||.  ...:|.
  Rat    15 LEAGTGLKLLKAASGERHSLLLFSNHRVYSCGDNSRGQL-------GQKSPQSTKRP--EPIQAL 70

  Fly   136 SSPIIEHIACGSHINVAISSENCVYS-------------------IPSCLHQFSERQFRVKQLQC 181
            |:..|:.::||...:||:..:..|::                   :|:.::..:  ..::.|:.|
  Rat    71 STVHIDLVSCGKEHSVAVCHQGRVFTWGAGSEGQLGIGESKEISFMPTKINSLA--GIKIIQVSC 133

  Fly   182 GHEHAVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFG 245
            ||.|::.|:.:|.||:||:..:|||||. .|..:.:||.:::|.||.:.|:||||.||.|:|..|
  Rat   134 GHYHSLALSEDGQVFSWGSNRQGQLGLGNNLCSQASPQKVKSLEGIPLAQVAAGGTHSFALSLMG 198

  Fly   246 DLYTWGLNCSGQLGL-------RVMKPG--GVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPL 301
            ..:.||.|.||||.|       ::.||.  |.||...|                          :
  Rat   199 TSFGWGNNRSGQLALSGNSAKEQIYKPHSIGALKTLNV--------------------------V 237

  Fly   302 RVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQ--DLSYVDAFQALEGITMNPTVDDVLCGPWS 364
            .:..|..||.::...|:::..|    |....|||  ..|.....|.:|||  ...|..:.||.:.
  Rat   238 YISCGYEHTSVLTEDGQVFTFG----GSSSEQLQHSPRSGRGGPQLIEGI--GGHVSQIECGSYH 296

  Fly   365 TLLHLKCT 372
            |:.::..|
  Rat   297 TIAYVYTT 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 85/325 (26%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 23/49 (47%)
RCC1_2 228..257 CDD:290274 14/28 (50%)
Herc6XP_008761185.1 RCC1 39..88 CDD:278826 12/57 (21%)
RCC1 92..141 CDD:278826 7/50 (14%)
RCC1 144..194 CDD:278826 23/49 (47%)
RCC1_2 182..210 CDD:290274 14/27 (52%)
RCC1_2 236..265 CDD:290274 7/58 (12%)
RCC1 252..299 CDD:278826 15/52 (29%)
HECTc 682..1023 CDD:238033
HECTc 706..1023 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.