DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcc1l

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001101802.1 Gene:Rcc1l / 360796 RGDID:1307558 Length:461 Species:Rattus norvegicus


Alignment Length:227 Identity:62/227 - (27%)
Similarity:100/227 - (44%) Gaps:34/227 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   142 HIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQL 206
            |..||..:     .|:.|||....:|:..:.:.:|.|:.||.:|::.|...|:|::.|.|..||.
  Rat   200 HGQCGRKV-----VEDEVYSESHKVHRMQDFEGQVVQVVCGQDHSLFLTDKGEVYSCGWGADGQT 259

  Fly   207 GLAELRVEETPQLLEA-LAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLK 270
            ||....:..||..|.. |||:.:.|:|..|....|:||.|.::.||  .|..|.|..:.....:.
  Rat   260 GLGHYNITSTPSKLGGDLAGVTVVQVATYGDCCLALSADGGVFGWG--NSEYLQLASVTDSTQVN 322

  Fly   271 EPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGR--Q 333
            .|...|...:..:.:.||..:|     ||            ::...|.::|.|   :|.||:  .
  Rat   323 VPRCLPFSGVGKVKQVACGGTG-----CA------------ILNEEGHVFVWG---YGILGKGPN 367

  Fly   334 LQDLSYVDAF-QALEGIT-MNP--TVDDVLCG 361
            |.:.:..:.. ..|.|:| .||  .|..:.||
  Rat   368 LSETALPEMIPPTLFGLTEFNPEVKVSQIRCG 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 62/227 (27%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 17/49 (35%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
Rcc1lNP_001101802.1 RCC1 127..186 CDD:278826
RCC1_2 173..202 CDD:290274 1/1 (100%)
RCC1 192..242 CDD:278826 13/46 (28%)
RCC1_2 229..258 CDD:290274 10/28 (36%)
RCC1 245..295 CDD:278826 17/49 (35%)
RCC1 298..348 CDD:278826 13/68 (19%)
RCC1_2 393..422 CDD:290274 3/7 (43%)
RCC1 409..452 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.