DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and tag-229

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001021670.1 Gene:tag-229 / 3565487 WormBaseID:WBGene00044065 Length:200 Species:Caenorhabditis elegans


Alignment Length:87 Identity:19/87 - (21%)
Similarity:30/87 - (34%) Gaps:19/87 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGI 226
            |||.:...|:     .:.:.....|::...|.:    ||   |..|:.:......|. :|...|.
 Worm    45 IPSFMTSSSD-----SEAEAAESSAIMAEMNPE----GN---GAYGMGQYTRHRAPH-VEFRVGD 96

  Fly   227 KITQIAAG------GWHSAAIS 242
            .||.....      ||...||:
 Worm    97 VITHTKLNFRGVIIGWDEHAIA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 19/87 (22%)
RCC1_2 176..205 CDD:290274 4/28 (14%)
RCC1 192..241 CDD:278826 12/54 (22%)
RCC1_2 228..257 CDD:290274 6/21 (29%)
tag-229NP_001021670.1 YccV-like 89..186 CDD:382598 8/31 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.