DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and rcbtb1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_956285.1 Gene:rcbtb1 / 336007 ZFINID:ZDB-GENE-030131-7951 Length:531 Species:Danio rerio


Alignment Length:286 Identity:65/286 - (22%)
Similarity:109/286 - (38%) Gaps:99/286 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 HCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPI----------IEH 142
            |.|::.:.|:||.......::|          .|..|.:.:        |||          :..
Zfish    86 HVLLVTEDGELYAWGHNGYSQL----------GNGTTNQGV--------SPILVSTNLQGKRVTE 132

  Fly   143 IACGSHINVAISSENCVYS----------------------IPSCLHQFSERQFRVKQLQCGHEH 185
            ::||||.::|::.|..|::                      :.:||     :...:..:.||...
Zfish   133 VSCGSHHSLALTHEGEVFAWGYNNCGQVGSGSTANQPTPRKVSNCL-----QNKVIVNIACGQTS 192

  Fly   186 AVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTW 250
            ::.:..||:|:.||....|||||.....:.||..|.||.|..:.|||:|..||.|::..|.||.|
Zfish   193 SMAVTDNGEVYGWGYNGNGQLGLGNNGNQLTPCRLIALQGFCVLQIASGYAHSLALTDEGLLYAW 257

  Fly   251 GLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRR 315
            |.|..||||                               :|..::..:|::|.......:.|..
Zfish   258 GANTYGQLG-------------------------------TGNKSNQLSPVQVMTEKERIVEIAA 291

  Fly   316 C------------GRLWVSGWCKHGQ 329
            |            |::::.|.|: ||
Zfish   292 CHSTHTSAAKTQSGQVYMWGQCR-GQ 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 65/286 (23%)
RCC1_2 176..205 CDD:290274 7/28 (25%)
RCC1 192..241 CDD:278826 22/48 (46%)
RCC1_2 228..257 CDD:290274 13/28 (46%)
rcbtb1NP_956285.1 RCC1 40..90 CDD:278826 2/3 (67%)
RCC1_2 77..106 CDD:290274 5/19 (26%)
RCC1 93..143 CDD:278826 13/67 (19%)
RCC1 146..196 CDD:278826 6/54 (11%)
RCC1 199..248 CDD:278826 22/48 (46%)
RCC1 251..299 CDD:278826 15/78 (19%)
BTB 360..464 CDD:279045
BTB 371..467 CDD:197585
SPOP_C_like 467..525 CDD:269810
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.