DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HERC2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_608388.2 Gene:HERC2 / 33035 FlyBaseID:FBgn0031107 Length:4912 Species:Drosophila melanogaster


Alignment Length:337 Identity:88/337 - (26%)
Similarity:122/337 - (36%) Gaps:128/337 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RVQPKLQ-----AELVAVRLEA--APRSNSG---TKRSIFGAAKAPSS----------------- 137
            |.||.||     |:.:|....|  .|.|.:|   ...|...||.||..                 
  Fly  2935 RQQPDLQHILANAQFLASEYSAGVGPGSTAGAGAVSTSHEEAAAAPEQDLPCTVMVWGLNDKEQL 2999

  Fly   138 ---------------------PIIEHIACGSHINVAISSENCVYS------------------IP 163
                                 ||  |||.||.....:|.:..||:                  :|
  Fly  3000 GGLKGSKVKVPTFSQTISRLRPI--HIAGGSKSLFIVSQDGKVYACGEGTNGRLGLGVTHNVPLP 3062

  Fly   164 SCLHQFSE-RQFRVKQ--LQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAG 225
               ||... ||:.||:  :..|.:||:.|..:|.||:||.|..|:||.......:.|:|:|||..
  Fly  3063 ---HQLPVLRQYVVKKVAVHSGGKHALALTLDGKVFSWGEGEDGKLGHGNRTTLDKPRLVEALRA 3124

  Fly   226 IKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQ 290
            .||..:|.|..||||||:.|:||||||...|:||                               
  Fly  3125 KKIRDVACGSSHSAAISSQGELYTWGLGEYGRLG------------------------------- 3158

  Fly   291 SGESNDDCAP-----------LRVFAGSR--HTLLIRRCGRLWVSGWCKHGQLGR---------- 332
            .|::.....|           ::|..|||  .||.:...|.::..|....|:|||          
  Fly  3159 HGDNTTQLKPKLVTALAGRRVVQVACGSRDAQTLALTEDGAVFSWGDGDFGKLGRGGSEGSDTPH 3223

  Fly   333 QLQDLSYVDAFQ 344
            :::.||.:...|
  Fly  3224 EIERLSGIGVVQ 3235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 88/337 (26%)
RCC1_2 176..205 CDD:290274 12/30 (40%)
RCC1 192..241 CDD:278826 21/48 (44%)
RCC1_2 228..257 CDD:290274 16/28 (57%)
HERC2NP_608388.2 RCC1 638..683 CDD:278826
RCC1 687..737 CDD:278826
RCC1 740..787 CDD:278826
RCC1 790..841 CDD:278826
RCC1_2 828..857 CDD:290274
Cyt-b5 1290..1363 CDD:278597
MIB_HERC2 1928..1987 CDD:284184
UBA_HERC2 2515..2559 CDD:270585
Cul7 2624..2699 CDD:288381
APC10-HERC2 2762..2932 CDD:176485
RCC1 3037..3088 CDD:278826 12/53 (23%)
RCC1 3091..3140 CDD:278826 21/48 (44%)
RCC1 3144..3194 CDD:278826 18/80 (23%)
RCC1 3197..3246 CDD:278826 9/39 (23%)
RCC1 3250..3298 CDD:278826
RCC1 3302..3350 CDD:278826
RCC1_2 4136..4166 CDD:290274
RCC1 4154..4203 CDD:278826
RCC1 4206..4257 CDD:278826
RCC1 4260..4309 CDD:278826
RCC1 4312..4360 CDD:278826
RCC1 4364..4413 CDD:278826
HECTc 4509..4880 CDD:238033
HECTc 4553..4878 CDD:214523
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.