DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Ibtk

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_038938472.1 Gene:Ibtk / 315858 RGDID:1311697 Length:1352 Species:Rattus norvegicus


Alignment Length:256 Identity:73/256 - (28%)
Similarity:114/256 - (44%) Gaps:54/256 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 GSHINVAI--SSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL 208
            |.:.|..:  .|:|..:. |..|..||..:..|||:.....|:|.|:..|.|:|.|:|..|:||.
  Rat   148 GDNTNFTLGHGSQNSKHH-PELLDLFSRSRVYVKQVVLCKFHSVFLSQQGQVYTCGHGRGGRLGH 211

  Fly   209 AELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPT 273
            .:.:....|:|:|.|:|...:|:||...|:..::..|.:||:|||...||        |::..|:
  Rat   212 GDEQTCLVPRLVEGLSGHSCSQVAAAKDHTVVLTEDGCVYTFGLNTFHQL--------GIIPPPS 268

  Fly   274 VFPLP-QLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRR--CGRLWVSGWCKHGQLG---- 331
            ...:| |:|     |....|.:     .:.|.||..||:|..|  ...|.::|    ||||    
  Rat   269 SCNVPRQIQ-----AKYLKGRT-----IIGVAAGRFHTVLWTREAVYTLGLNG----GQLGHLLD 319

  Fly   332 ----------RQLQDLSYVDAFQAL----EGITMNPT-------VDDVLCGPWST-LLHLK 370
                      ||:..|.:.|...:|    :|.|:..|       :.|..|...:| .|:||
  Rat   320 PNGEKCVTTPRQVSALHHKDIAVSLVAASDGATVCVTTRGDIYLLADYQCKKMATKQLNLK 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 73/256 (29%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
IbtkXP_038938472.1 Ank_2 <45..116 CDD:403870
ANK repeat 51..82 CDD:293786
ANK repeat 84..116 CDD:293786
ATS1 139..>341 CDD:227511 63/215 (29%)
RCC1 247..299 CDD:395335 20/69 (29%)
BTB1_POZ_IBtk 547..652 CDD:349610
BTB2_POZ_IBtk 764..876 CDD:349611
BACK_IBtk 872..931 CDD:350575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.