DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Herc2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006229362.1 Gene:Herc2 / 308669 RGDID:1307989 Length:4836 Species:Rattus norvegicus


Alignment Length:327 Identity:75/327 - (22%)
Similarity:122/327 - (37%) Gaps:127/327 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IGWRYAALAFGRKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAE 108
            |||:|.|...            ||.:|..|.:.| :..:|.|:...|:|.::|::|  .....::
  Rat   432 IGWKYYANVI------------GPIQCEGLASLG-VMQVACAEKRFLILSRNGRVY--TQAYNSD 481

  Fly   109 LVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQ 173
            ::|.:|                         ::.:|..:.:.:|..|:                 
  Rat   482 MLAPQL-------------------------VQGLASRNIVKIAAHSD----------------- 504

  Fly   174 FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEAL----AGIKITQIAAG 234
                    || |.:.|.|.|:|::||.|..|:||..:....|.|:::.|.    ||..:..||.|
  Rat   505 --------GH-HYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACG 560

  Fly   235 GWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCA 299
            ..:||||:|.|:|||||....|:||                               .|.|.|:..
  Rat   561 STYSAAITAEGELYTWGRGNYGRLG-------------------------------HGSSEDEAI 594

  Fly   300 PLRVF-------------AGSRHTLLIRRCGRLWVSGWCKHGQLGR-------------QLQDLS 338
            |:.|.             :|...||.:...|::|..|...:|:|||             :||||.
  Rat   595 PMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLD 659

  Fly   339 YV 340
            .:
  Rat   660 VI 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 65/293 (22%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 18/52 (35%)
RCC1_2 228..257 CDD:290274 14/28 (50%)
Herc2XP_006229362.1 ATS1 <494..787 CDD:227511 56/225 (25%)
Cyt-b5 1212..1283 CDD:395121
MIB_HERC2 1871..1931 CDD:399589
UBA_HERC2 2461..2508 CDD:270585
Cul7 2555..2632 CDD:402903
SH3_15 2640..2697 CDD:408152
ZZ_HERC2 2707..2751 CDD:239084
APC10-HERC2 2766..2911 CDD:176485
ATS1 2957..3323 CDD:227511
ATS1 4025..4330 CDD:227511
HECTc 4423..4794 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.