DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcbtb2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_038949091.1 Gene:Rcbtb2 / 290363 RGDID:735048 Length:585 Species:Rattus norvegicus


Alignment Length:334 Identity:80/334 - (23%)
Similarity:130/334 - (38%) Gaps:76/334 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SELNAPVSTQN---QCTIS------IG-WRYAALA------FGRKLCLRGLLDDGPNECVTLEAT 76
            ::..||..:.|   |.|:|      :| |...:|.      ..|:.|:.|   ...||.:.....
  Rat    37 TKFQAPEHSSNQSVQATLSSLKMLDVGKWPIFSLCSEEELQLIRQACVFG---TAGNEVLYTTVN 98

  Fly    77 GNIRALAAADSHCLVL--LQSGQLYRVQPKLQAELVAVRLEAAPRSNSG-------TKRSIF--- 129
            ..|..|....|.||.:  :||    .::|:....|...:: |:....||       |...:|   
  Rat    99 DEIFVLGTNCSGCLGVGDIQS----TIEPRRLDSLTGKKI-ASLSYGSGPHIVLATTDGEVFTWG 158

  Fly   130 -GAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANG 193
             .|.....:....|.....||:..:|::                  :|.::.||..|:::|.::|
  Rat   159 HNAYSQLGNGTTNHGLVPCHISTNLSNK------------------QVIEVACGSYHSLVLTSDG 205

  Fly   194 DVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKIT-QIAAGGWHSAAISAFGDLYTWGLNCSGQ 257
            :||.||....||:|......:..|:.:......|:. .||.|...|.|:...|::|.||.|.:||
  Rat   206 EVFAWGYNNSGQVGSGSTANQPIPRRVTGCLQNKVVMSIACGQMCSMAVVDTGEVYVWGYNGNGQ 270

  Fly   258 LGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVS 322
            |||     |....:||...:..||.:               ...||..|..|||::...|:::..
  Rat   271 LGL-----GSSGNQPTPCRVAALQGI---------------RVQRVACGYAHTLVLTDEGQIYAW 315

  Fly   323 GWCKHGQLG 331
            |...:||||
  Rat   316 GANSYGQLG 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 66/268 (25%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 14/49 (29%)
RCC1_2 228..257 CDD:290274 10/29 (34%)
Rcbtb2XP_038949091.1 ATS1 <141..421 CDD:227511 56/222 (25%)
BTB_POZ_RCBTB2_CHC1L 408..524 CDD:349663
BACK_RCBTB2 521..585 CDD:350604
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.