| Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_835464.1 | Gene: | NEK8 / 284086 | HGNCID: | 13387 | Length: | 692 | Species: | Homo sapiens |
| Alignment Length: | 438 | Identity: | 90/438 - (20%) |
|---|---|---|---|
| Similarity: | 136/438 - (31%) | Gaps: | 153/438 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 70 CVTLEATGNIRALAAADSHCLVL-LQSG------------------QLYRVQP------------ 103
Fly 104 --------KLQAELVAVRLEAAPR----SNSGTKRSIFGAAKAPSSPI----------------- 139
Fly 140 -------------IEHIACG--SHINVAISSENCVYSI-------------------PSCLHQFS 170
Fly 171 ERQ--FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAA 233
Fly 234 GGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECAC---------- 288
Fly 289 --------------------------------------SQSGESNDDCAP-LRVFAGSRHTLLIR 314
Fly 315 RCGRLWVSGWCKHGQLGRQLQDLSYVDA-FQALEGITMNPTVDDVLCG 361 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 87/430 (20%) |
| RCC1_2 | 176..205 | CDD:290274 | 8/28 (29%) | ||
| RCC1 | 192..241 | CDD:278826 | 17/48 (35%) | ||
| RCC1_2 | 228..257 | CDD:290274 | 10/28 (36%) | ||
| NEK8 | NP_835464.1 | STKc_Nek8 | 3..258 | CDD:270859 | 14/66 (21%) |
| RCC1 | 276..657 | CDD:332518 | 73/353 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 277..301 | 5/23 (22%) | |||
| RCC1 1 | 312..350 | 3/37 (8%) | |||
| RCC1 2 | 410..461 | 19/50 (38%) | |||
| RCC1 3 | 462..513 | 13/53 (25%) | |||
| RCC1 4 | 580..631 | 17/46 (37%) | |||
| RCC1 5 | 632..684 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.010 | |||||