DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HECTD4

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001103132.4 Gene:HECTD4 / 283450 HGNCID:26611 Length:4428 Species:Homo sapiens


Alignment Length:356 Identity:76/356 - (21%)
Similarity:103/356 - (28%) Gaps:127/356 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 QAELVAVRLEAAPRSNSGTKRSIFGA-AKAPSSPIIEHIACGSHINVAISSENCV---------- 159
            :|||:   |.....:.||..|||.|. |:.|        ||.|      :||..|          
Human  1487 RAELL---LHVTIAAQSGLTRSISGTPAETP--------ACKS------ASETKVISHAVRQPVF 1534

  Fly   160 ---YSIPSCL------------------HQFSERQFRVKQLQC--------GHEHAVLLNANGDV 195
               .|.||.|                  |..|.|......||.        ...::|||   |.:
Human  1535 LRSMSAPSDLEMIGNEDLEFTRANQRRRHVTSHRSSSFTLLQSLAIEDSRDKPTYSVLL---GQL 1596

  Fly   196 FT----------------------WGNGLRGQLGLAELRVEET-------------PQLLEALAG 225
            |.                      |..|...:..|..:|...|             |..:....|
Human  1597 FAFIGTNPDQAVSSSSFLLAAQTRWRRGNTRKQALVHMRELLTAAVRVGGVTHLVGPVTMVLQGG 1661

  Fly   226 IKITQIAAGGWHSAAISAFGDLYT--------WGLNCSGQLGLRVMKPGGVLKEPTVF--PLPQL 280
            .:|.::..||.......|||:..|        :.:.|:..:||....|....:|..:.  .|.||
Human  1662 PRIEELTCGGMVEQVQEAFGETMTSVVSLCARYPIACANSIGLLCTIPYTRSEEKCLVRSGLVQL 1726

  Fly   281 QD----LPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCK---------HGQLGR 332
            .|    |.....|.|.|.......:...|.:...:|..||..     |.|         |..|.|
Human  1727 MDRLCSLSNQTESSSSEKQTKKQKVATMAWAAFQVLANRCVE-----WEKEEGGSTEAVHSGLAR 1786

  Fly   333 QLQDLSYVDAFQALE----GITMNPTVDDVL 359
            |:..|......:|.|    ....|..:.|||
Human  1787 QVSSLLTNHLARATECCGNQAAGNDALQDVL 1817

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 76/356 (21%)
RCC1_2 176..205 CDD:290274 9/58 (16%)
RCC1 192..241 CDD:278826 12/83 (14%)
RCC1_2 228..257 CDD:290274 8/36 (22%)
HECTD4NP_001103132.4 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.