DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Sergef

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006541006.1 Gene:Sergef / 27414 MGIID:1351630 Length:465 Species:Mus musculus


Alignment Length:399 Identity:92/399 - (23%)
Similarity:133/399 - (33%) Gaps:100/399 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GFSELNAPVSTQNQCTISIGWR-YAALAFGRKLCLRGLLDDG--PNECVTLEATGNIRALAAADS 87
            ||....:|......|....|.. |..|..|.|       :|.  |.:.......|.|:::.....
Mouse     3 GFFPAPSPWGASCGCEACGGANSYGQLGLGHK-------EDVFLPQQLSDFCQAGCIKSVTGGGG 60

  Fly    88 HCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVA 152
            |..|:...|.|:........:|.....|...|         |...|......|..:|||....:.
Mouse    61 HSAVVTDGGDLFVCGLNKDGQLGLGHTEEVLR---------FTICKPLRGCPIRQVACGWDFTIM 116

  Fly   153 ISSENCVYS-------------------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTW 198
            ::.:..|.|                   :|..:....|   :|..:..|..||:...|.|.||.|
Mouse   117 LTEKGQVLSCGSNAFGQLGVPHGPRKCVVPQAIECLRE---KVVCVAAGLRHALATTATGSVFQW 178

  Fly   199 GNGLRGQLGLAELRVEETPQLLEALAGIKITQI--------AAGGWHSAAISAFGDLYTWGLNCS 255
            |.||... |......:..|..|.|....::|.:        .||..|||:::..|:||.||.|..
Mouse   179 GTGLASS-GRRLCPGQNLPLFLTAKEPSRVTGLENSTAVCAVAGSDHSASLTDTGELYVWGRNKH 242

  Fly   256 GQLGLRVMKPGGVLKEPTVFPLPQ------LQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIR 314
            |||..|.:          ..||||      .||....|               |::|..|.:...
Mouse   243 GQLASRAV----------FLPLPQRIEAHYFQDEKVTA---------------VWSGWTHLVAKT 282

  Fly   315 RCGRLWVSGWCKHGQLGRQL----------QDLSYVDAFQALEGITMNPT-----VDDVLCGPWS 364
            ..|:::..|...:|||||:|          ||.|.  |||..:....:|.     ..::.||...
Mouse   283 ETGKVFTWGRADYGQLGRRLEPPEAQKPVEQDSSL--AFQGPQNSVPSPLHCLTGATEISCGSEH 345

  Fly   365 TL--LHLKC 371
            .|  :..||
Mouse   346 NLAVIRDKC 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 78/342 (23%)
RCC1_2 176..205 CDD:290274 12/28 (43%)
RCC1 192..241 CDD:278826 17/56 (30%)
RCC1_2 228..257 CDD:290274 12/36 (33%)
SergefXP_006541006.1 ATS1 22..370 CDD:227511 88/380 (23%)
RCC1 356..402 CDD:366085
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.