DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Hectd4

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006530414.1 Gene:Hectd4 / 269700 MGIID:3647820 Length:4525 Species:Mus musculus


Alignment Length:382 Identity:80/382 - (20%)
Similarity:114/382 - (29%) Gaps:123/382 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 IRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGA-AKAPSSPIIEH 142
            :.:||...||  .|.::..|.|.... :|||:   |.....:.:|..|||.|. |:.|       
Mouse  1556 VNSLAQKPSH--PLAKTKTLVRSLMN-RAELL---LHVTIAAQAGLTRSISGTPAETP------- 1607

  Fly   143 IACGSHINVAISS---ENCVY----SIPSCLHQFSERQF---RVKQ--LQCGHEH---------- 185
             ||.|.....::|   ...|:    |.||.|........   |..|  :.|...|          
Mouse  1608 -ACKSASETKVASHAVRQPVFLRSMSAPSDLEMIGNEDLEFTRANQSLVFCRRRHVTSHRSSSFT 1671

  Fly   186 ----------------AVLLNANGDVFT----------------------WGNGLRGQLGLAELR 212
                            :|||   |.:|.                      |..|...:..|..:|
Mouse  1672 LLQSLAIEDSRDKPTYSVLL---GQLFAFIGTNPDQAVSSSSFLLAAQTRWRRGNTRKQALVHMR 1733

  Fly   213 VEET-------------PQLLEALAGIKITQIAAGGWHSAAISAFGDLYT--------WGLNCSG 256
            ...|             |..:....|.:|.::..||.......|||:..|        :.:.|:.
Mouse  1734 ELLTAAVRVGGVTHLVGPVTMVLQGGPRIEELTCGGMVEQVQEAFGETMTSVVSLCARYPIACAN 1798

  Fly   257 QLGLRVMKPGGVLKEPTVF--PLPQLQD----LPECACSQSGESNDDCAPLRVFAGSRHTLLIRR 315
            .:||....|....:|..:.  .|.||.|    |.....|.|.|.......:...|.:...:|..|
Mouse  1799 SIGLLCTIPYTRSEEKCLVRSGLVQLMDRLCSLSSQTESSSSEKQTKKQKVATMAWAAFQVLANR 1863

  Fly   316 CGRLWVSGWCK---------HGQLGRQLQDLSYVDAFQALE----GITMNPTVDDVL 359
            |..     |.|         |..|.||:..|......:|.|    ....|..:.|||
Mouse  1864 CVE-----WEKEEGGSTEAVHSGLARQVSSLLTNHLARATECCGNQAAGNDALQDVL 1915

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 80/382 (21%)
RCC1_2 176..205 CDD:290274 10/78 (13%)
RCC1 192..241 CDD:278826 12/83 (14%)
RCC1_2 228..257 CDD:290274 8/36 (22%)
Hectd4XP_006530414.1 CCDC154 149..>233 CDD:373856
SPRY_HECT_like 2507..2662 CDD:293970
HECTc 4127..4520 CDD:391658
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.