DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and HERC4

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:357 Identity:83/357 - (23%)
Similarity:130/357 - (36%) Gaps:136/357 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLDDG---------------------PNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKL 105
            :||||                     |.:.|.|:|. ||.|::..::|.|.|...||:|      
Human    49 VLDDGTVYTCGCNDLGQLGHEKSRKKPEQVVALDAQ-NIVAVSCGEAHTLALNDKGQVY------ 106

  Fly   106 QAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQF- 169
                       |...:|..:..:.|                        ||.|: .:|||..:. 
Human   107 -----------AWGLDSDGQLGLVG------------------------SEECI-RVPSCFPKIM 135

  Fly   170 ---------------------SERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL-AELR 212
                                 |....::.|:.||:.|::.|:...:||.||....||||| .:.:
Human   136 CVDSLVRICSGLSYGRIRNIKSLSDIQIVQVACGYYHSLALSKASEVFCWGQNKYGQLGLGTDCK 200

  Fly   213 VEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPL 277
            .:.:||||::|.||...|:||||.||..::..|.::.||.|..|||||                 
Human   201 KQTSPQLLKSLLGIPFMQVAAGGAHSFVLTLSGAIFGWGRNKFGQLGL----------------- 248

  Fly   278 PQLQDLPECACSQSGESNDDCAP-----LR------VFAGSRHTLLIRRCGRLWVSGWCKHGQLG 331
                          .:.||...|     ||      :..|..||..:.:.|.::..|...:||||
Human   249 --------------NDENDRYVPNLLKSLRSQKIVYICCGEDHTAALTKEGGVFTFGAGGYGQLG 299

  Fly   332 RQ--LQDLSYVDAFQALEGITMNPTVDDVLCG 361
            ..  ..:::....|:.:..|     |.::.||
Human   300 HNSTSHEINPRKVFELMGSI-----VTEIACG 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 75/320 (23%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 23/49 (47%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518 83/357 (23%)
HECTc 733..1079 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.