DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and ZZEF1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_016879871.1 Gene:ZZEF1 / 23140 HGNCID:29027 Length:2966 Species:Homo sapiens


Alignment Length:367 Identity:70/367 - (19%)
Similarity:114/367 - (31%) Gaps:116/367 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 SELNAPVSTQNQCTISIGWRYAALAFGRKLCLRGLLDDG---PNECVTLEA---TGNIRALAAAD 86
            :|:| |.|...:|            ..:.|.|...|..|   ...|..||.   |.:::.|....
Human  1410 TEVN-PESLAKEC------------IEKSLLLLKFLPTGISSKESCEKLETADETSHLQPLNKRQ 1461

  Fly    87 SHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINV 151
            ....|         |:...||.:...  ||||.:.......:....|.|||..:.    .:.::.
Human  1462 RTSSV---------VEEHFQASVSPT--EAAPPATGDQSPGLGTQPKLPSSSGLP----AADVSP 1511

  Fly   152 AISSENCVYSIPSCLHQFSERQFRVKQLQCGHE----------HAVLLNANGDVFTWGNGLRGQL 206
            |.:.|....|.|:....|:..:.|:...:...|          :.||.:....:.......|..:
Human  1512 ATAEEPLSPSTPTRRPPFTRGRLRLLSFRSMEEARLVPTVKEKYPVLKDVMDFIKDQSLSHRSVV 1576

  Fly   207 GLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKE 271
            .:..||..:...:||.|   ||||                      :|:..||           :
Human  1577 KVLSLRKAQAQSILEVL---KITQ----------------------HCAESLG-----------Q 1605

  Fly   272 PTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQD 336
            |..|..|.:..|.|....|...:|        :.|.     :..||          ..|.::::|
Human  1606 PHCFHPPFILFLLELLTCQKDFTN--------YFGH-----LEGCG----------ADLHKEIRD 1647

  Fly   337 LSY---------VDAFQALEGITMNPTVDDVLCGPWSTLLHL 369
            ..|         |..|.:|...::.|.:..|    .:.||||
Human  1648 TYYQLVLFLVKAVKGFSSLNDRSLLPALSCV----QTALLHL 1685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 57/311 (18%)
RCC1_2 176..205 CDD:290274 4/38 (11%)
RCC1 192..241 CDD:278826 10/48 (21%)
RCC1_2 228..257 CDD:290274 4/28 (14%)
ZZEF1XP_016879871.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.