DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rpgr

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001171421.1 Gene:Rpgr / 19893 MGIID:1344037 Length:1039 Species:Mus musculus


Alignment Length:332 Identity:81/332 - (24%)
Similarity:126/332 - (37%) Gaps:66/332 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 LAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIF--GAAKAPSSPIIEHIA 144
            |:..|.|..::..:.:||........:|           ..|:|.:|.  ...||.....::..|
Mouse    78 LSCGDEHTAIVTGNNKLYMFGSNNWGQL-----------GLGSKAAIIKPTCIKALKPEKVKLAA 131

  Fly   145 CGSHINVAISSENCVYSI---------------PSCLHQ--FSERQFRVKQLQCGHEHAVLLNAN 192
            ||.:..:..:....||:.               ....||  |......:|||..|...:..|..:
Mouse   132 CGRNHTLVSTDTGGVYAAGGNNEGQLGLGDTDDRDTFHQIVFFTPADTIKQLSAGANTSAALTED 196

  Fly   193 GDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQ 257
            |.:|.||:...||:||.:......|.  |...|..|:.|:.|.:|||.::..|:|||:|...:|:
Mouse   197 GKLFMWGDNSEGQIGLEDKSNVCIPH--EVTVGKPISWISCGYYHSAFVTMDGELYTFGEPENGK 259

  Fly   258 LGL-------------------RVMK---PGG---VLKEPTV--FPLPQLQDLP------ECACS 289
            |||                   ||::   .||   ||.|..|  |.|.|...|.      |.:..
Mouse   260 LGLPNELLMNHRSPQRVLGIPERVIQVACGGGHTVVLTEKVVYAFGLGQFGQLGLGTFLFETSEP 324

  Fly   290 QSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALEGITMNPT 354
            :..|...|.....:..|..||.|:...|.|:..|..:||:||..:::.:. ..|..|....:...
Mouse   325 KIIERIKDQKICHISCGENHTALMTELGLLYTFGDGRHGKLGLGMENFTN-QFFPTLCSNFLRFA 388

  Fly   355 VDDVLCG 361
            |..:.||
Mouse   389 VQLIACG 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 81/332 (24%)
RCC1_2 176..205 CDD:290274 9/28 (32%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
RpgrNP_001171421.1 RCC1_2 78..104 CDD:290274 5/25 (20%)
RCC1 93..139 CDD:278826 11/56 (20%)
RCC1 144..193 CDD:278826 9/48 (19%)
RCC1_2 180..209 CDD:290274 9/28 (32%)
RCC1 196..243 CDD:278826 17/48 (35%)
RCC1 246..296 CDD:278826 13/49 (27%)
RCC1 301..348 CDD:278826 11/46 (24%)
RCC1 352..398 CDD:278826 12/45 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.