DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Zzef1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006532664.1 Gene:Zzef1 / 195018 MGIID:2444286 Length:2953 Species:Mus musculus


Alignment Length:342 Identity:72/342 - (21%)
Similarity:116/342 - (33%) Gaps:89/342 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LLFTGFNAFGQH----ECVSGD-VDCAAGFSELNAPVSTQNQCTISIG--WRYAALAFGRK-LCL 59
            |||.....:..|    |.|.|: :|..|   ..|| .:.::||...:|  ...|....|.| |.|
Mouse  1899 LLFAALALYSAHLTSTEQVDGEQLDPQA---RTNA-ATLRSQCMQLVGDCLMKAHQGKGLKALAL 1959

  Fly    60 RGLLDDGPNECVTLEATGNIRAL------AAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAP 118
            .|:|.||       ::|...:||      .|::...    .:|.|.....|..|:.....|:...
Mouse  1960 LGVLPDG-------DSTSENQALPVTVSFQASEEQA----DAGLLVPCNGKRAADTEVRPLDYKQ 2013

  Fly   119 RSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGH 183
            :..:|...||   .|.||        |.:.::.|.:|.:....:|...|.....|..|:      
Mouse  2014 KKKAGEDLSI---VKDPS--------CQTQVSDAPASAHVPPGLPDAEHPEVSAQVLVE------ 2061

  Fly   184 EHAVLLNANGDVFTWGNGLR--GQLGLAELRVEETPQL----LEALAGIKITQIAAGGWHSAAIS 242
            |.|:..|.. .||...:..|  |.|......::..|.:    ||.:..:....:.:...|     
Mouse  2062 EKAITPNPE-QVFAECSQKRILGLLAAMLPPIKSGPTVPLIDLEHVLPLMFQVVISNAGH----- 2120

  Fly   243 AFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCAPLRVFAGS 307
             ..:.|...|...|||.:| ::|..|                            |.|.::|.: :
Mouse  2121 -LNETYHLTLGLLGQLIIR-LQPAEV----------------------------DAAVMKVLS-A 2154

  Fly   308 RHTLLIRRCGRLWVSGW 324
            :|.|.......:...||
Mouse  2155 KHNLFATADNAVVPDGW 2171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 48/259 (19%)
RCC1_2 176..205 CDD:290274 7/30 (23%)
RCC1 192..241 CDD:278826 9/54 (17%)
RCC1_2 228..257 CDD:290274 3/28 (11%)
Zzef1XP_006532664.1 EFh <94..141 CDD:238008
APC10-ZZEF1 250..380 CDD:176488
CUB <1119..1189 CDD:381774
ZZ_EF 1779..1826 CDD:239083
ZZ 1828..1875 CDD:239069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.