Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_620776.1 | Gene: | nek8 / 171094 | ZFINID: | ZDB-GENE-020509-1 | Length: | 697 | Species: | Danio rerio |
Alignment Length: | 458 | Identity: | 93/458 - (20%) |
---|---|---|---|
Similarity: | 146/458 - (31%) | Gaps: | 178/458 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 70 CVTLEATGNIRALAAADSHCLVL-LQSGQLY----RVQPKLQ---------------------AE 108
Fly 109 LVAVR-----------------------LEAAPRSNSG----TKRSIFGAAKAPSS------PII 140
Fly 141 EHIACGSHINV-----AISSENCVYSI-------------------------------------P 163
Fly 164 SCLHQFSERQ--FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGI 226
Fly 227 KITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLP------- 284
Fly 285 -----EC-----------AC-------------SQSGESNDDC-------------APLR----- 302
Fly 303 -VFAGSRHTLLIRRCGRLWVSGWCKHGQLG---RQLQDLSYVDAFQALEGITMNPTVDDVLCGPW 363
Fly 364 STL 366 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 90/450 (20%) |
RCC1_2 | 176..205 | CDD:290274 | 8/28 (29%) | ||
RCC1 | 192..241 | CDD:278826 | 15/48 (31%) | ||
RCC1_2 | 228..257 | CDD:290274 | 6/28 (21%) | ||
nek8 | NP_620776.1 | STKc_Nek8 | 3..258 | CDD:270859 | 16/66 (24%) |
S_TKc | 4..255 | CDD:214567 | 15/63 (24%) | ||
ATS1 | 309..662 | CDD:227511 | 71/340 (21%) | ||
RCC1 1 | 417..468 | 16/50 (32%) | |||
RCC1 2 | 469..520 | 11/59 (19%) | |||
RCC1 3 | 521..586 | 10/64 (16%) | |||
RCC1 4 | 587..636 | 18/53 (34%) | |||
RCC1 5 | 637..689 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1062377at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |