DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Herc2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001347009.1 Gene:Herc2 / 15204 MGIID:103234 Length:4836 Species:Mus musculus


Alignment Length:327 Identity:75/327 - (22%)
Similarity:122/327 - (37%) Gaps:127/327 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 IGWRYAALAFGRKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAE 108
            |||:|.|...            ||.:|..|.:.| :..:|.|:...|:|.::|::|  .....::
Mouse   432 IGWKYYANVI------------GPIQCEGLASLG-VMQVACAEKRFLILSRNGRVY--TQAYNSD 481

  Fly   109 LVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQ 173
            ::|.:|                         ::.:|..:.:.:|..|:                 
Mouse   482 MLAPQL-------------------------VQGLASRNIVKIAAHSD----------------- 504

  Fly   174 FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEAL----AGIKITQIAAG 234
                    || |.:.|.|.|:|::||.|..|:||..:....|.|:::.|.    ||..:..||.|
Mouse   505 --------GH-HYLALAATGEVYSWGCGDGGRLGHGDTVPLEEPKVISAFSGKQAGKHVVHIACG 560

  Fly   235 GWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDDCA 299
            ..:||||:|.|:|||||....|:||                               .|.|.|:..
Mouse   561 STYSAAITAEGELYTWGRGNYGRLG-------------------------------HGSSEDEAI 594

  Fly   300 PLRVF-------------AGSRHTLLIRRCGRLWVSGWCKHGQLGR-------------QLQDLS 338
            |:.|.             :|...||.:...|::|..|...:|:|||             :||||.
Mouse   595 PMLVAGLKGLKVIDVACGSGDAQTLAVTENGQVWSWGDGDYGKLGRGGSDGCKTPKLIEKLQDLD 659

  Fly   339 YV 340
            .:
Mouse   660 VI 661

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 65/293 (22%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 18/52 (35%)
RCC1_2 228..257 CDD:290274 14/28 (50%)
Herc2NP_001347009.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 58..90
RCC1 1-1 416..462 12/42 (29%)
RCC1 1-2 463..513 13/102 (13%)
ATS1 <494..787 CDD:227511 56/225 (25%)
RCC1 1-3 514..569 20/54 (37%)
RCC1 1-4 570..621 17/81 (21%)
RCC1 1-5 624..675 11/38 (29%)
RCC1 1-6 676..727
RCC1 1-7 729..779
Cyt-b5 1212..1283 CDD:365921
MIB_HERC2 1871..1930 CDD:369043
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2351..2376
UBA_HERC2 2461..2508 CDD:270585
Cul7 2555..2632 CDD:371573
SH3_15 2640..2697 CDD:375773
ZZ_HERC2 2707..2751 CDD:239084
APC10-HERC2 2766..2911 CDD:176485
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2928..2947
ATS1 2957..3323 CDD:227511
RCC1 2-1 2959..3010
RCC1 2-2 3011..3065
RCC1 2-3 3066..3117
RCC1 2-4 3119..3169
RCC1 2-5 3172..3223
RCC1 2-6 3225..3275
RCC1 2-7 3276..3327
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3479..3499
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3517..3537
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 3604..3632
RCC1 3-1 3953..4004
RCC1 3-2 4006..4058
ATS1 4025..4330 CDD:227511
RCC1 3-3 4060..4110
RCC1 3-4 4112..4164
RCC1 3-5 4166..4216
RCC1 3-6 4218..4268
RCC1 3-7 4270..4320
HECTc 4423..4794 CDD:238033
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 4806..4836
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.