DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Nek8

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_006532246.1 Gene:Nek8 / 140859 MGIID:1890646 Length:702 Species:Mus musculus


Alignment Length:328 Identity:82/328 - (25%)
Similarity:116/328 - (35%) Gaps:103/328 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 PKLQAELVAVR----------------LEAAPRSNSGTKRSIFGAAKAPSSPIIEHIACGSHINV 151
            |.|..|:|.|.                |..||...:|....:.||.:.|.               
Mouse   334 PMLNTEVVQVAAGRTQKAGVTRSGRLILWEAPPLGAGGGTLLPGAVELPQ--------------- 383

  Fly   152 AISSENCVYSIPSCLHQFSERQ--FRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVE 214
                       |..:.:|.|.|  ..:|.:.||......|...|.:.|:|:|..|.||...|...
Mouse   384 -----------PQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMTFGSGSNGCLGHGNLTDI 437

  Fly   215 ETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGL------------------- 260
            ..|.::|||.|.::.|:|.|..|..|:|..|:|:.||....|:|||                   
Mouse   438 SQPTIVEALLGYEMVQVACGASHVLALSTDGELFAWGRGDGGRLGLGTRESHNCPQQVPVAPGQE 502

  Fly   261 --RVM----------KPGGVL------------------KEPTVFPLPQLQDLPECACSQSGESN 295
              ||:          .||.||                  :||.  |..|:::  ..:.:..|.:.
Mouse   503 AQRVVCGIDSSMILTSPGRVLACGSNRFNKLGLDHLSLDEEPV--PYQQVEE--ALSFTPLGSAP 563

  Fly   296 DDCAPLR-VFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDA-FQALEGITMNPTVDDV 358
            .|..||. |..|:.|:..|...|..:..|..:|||||...:.:|.... .|.||||.|..    |
Mouse   564 LDQEPLLCVDLGTAHSAAITASGDCYTFGSNQHGQLGTSSRRVSRAPCRVQGLEGIKMVM----V 624

  Fly   359 LCG 361
            .||
Mouse   625 ACG 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 82/328 (25%)
RCC1_2 176..205 CDD:290274 8/28 (29%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
Nek8XP_006532246.1 STKc_Nek8 3..258 CDD:270859
ATS1 318..663 CDD:227511 82/328 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.