DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RCC1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001041659.1 Gene:RCC1 / 1104 HGNCID:1913 Length:452 Species:Homo sapiens


Alignment Length:275 Identity:64/275 - (23%)
Similarity:97/275 - (35%) Gaps:77/275 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 PNECVTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSGTKRSIFGA 131
            |.:.|..||.|         .|.:.|.:|||:|......:..|             |...|:.|:
Human    97 PEDVVQAEAGG---------MHTVCLSKSGQVYSFGCNDEGAL-------------GRDTSVEGS 139

  Fly   132 AKAPSSPIIEHIACGSHINVAISSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVF 196
            ...|..                                .|.|.:|.|:..|..|...|..:|.||
Human   140 EMVPGK--------------------------------VELQEKVVQVSAGDSHTAALTDDGRVF 172

  Fly   197 TWGN--GLRGQLGLAE-LRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQL 258
            .||:  ...|.:||.| ::....|  ::....:.:.::|:|..|...::|.|||||.|....|||
Human   173 LWGSFRDNNGVIGLLEPMKKSMVP--VQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQL 235

  Fly   259 GLRVMKPGGVLKEPTVFP-------LPQLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRRC 316
            |          :.|.:|.       |.:|. :|:|...:|..|.........|.|:..|..|...
Human   236 G----------RVPELFANRGGRQGLERLL-VPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHE 289

  Fly   317 GRLWVSGWCKHGQLG 331
            |.::..|...:.|||
Human   290 GHVYGFGLSNYHQLG 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 59/264 (22%)
RCC1_2 176..205 CDD:290274 10/30 (33%)
RCC1 192..241 CDD:278826 13/51 (25%)
RCC1_2 228..257 CDD:290274 10/28 (36%)
RCC1NP_001041659.1 RCC1 66..113 CDD:278826 6/24 (25%)
RCC1 116..165 CDD:278826 15/93 (16%)
RCC1 168..218 CDD:278826 13/51 (25%)
RCC1 221..286 CDD:278826 21/75 (28%)
RCC1 289..340 CDD:278826 5/16 (31%)
RCC1 343..386 CDD:278826
RCC1 394..445 CDD:278826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.