DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and RCBTB2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_016875858.1 Gene:RCBTB2 / 1102 HGNCID:1914 Length:561 Species:Homo sapiens


Alignment Length:304 Identity:76/304 - (25%)
Similarity:118/304 - (38%) Gaps:86/304 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 RKLCLRGLLDDGPNECVTLEATGNIRALAAADSHCLVL--LQSGQLYRVQPKLQAELVAVRLEAA 117
            |:.|:.|   ...||.:.......|..|......||.|  :||    .::|:        ||:  
Human    56 RQACVFG---SAGNEVLYTTVNDEIFVLGTNCCGCLGLGDVQS----TIEPR--------RLD-- 103

  Fly   118 PRSNSGTKRSIFGAAKAPSSPIIEHIAC-----GSHINVAISSENCVYS---------------- 161
              |.:|.|                 |||     |.|| |..::|..|::                
Human   104 --SLNGKK-----------------IACLSYGSGPHI-VLATTEGEVFTWGHNAYSQLGNGTTNH 148

  Fly   162 --IPSCLH-QFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETP-QLLEA 222
              :|..:. ..|.:|  |.::.||..|:::|.::|:||.||....||:|......:..| ::...
Human   149 GLVPCHISTNLSNKQ--VIEVACGSYHSLVLTSDGEVFAWGYNNSGQVGSGSTVNQPIPRRVTGC 211

  Fly   223 LAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECA 287
            |....:..||.|.....|:...|::|.||.|.:|||||     |....:||...:..||.:    
Human   212 LQNKVVVTIACGQMCCMAVVDTGEVYVWGYNGNGQLGL-----GNSGNQPTPCRVAALQGI---- 267

  Fly   288 CSQSGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLG 331
                       ...||..|..|||::...|:::..|...:||||
Human   268 -----------RVQRVACGYAHTLVLTDEGQVYAWGANSYGQLG 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 71/281 (25%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 13/49 (27%)
RCC1_2 228..257 CDD:290274 9/28 (32%)
RCBTB2XP_016875858.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.