Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_776292.1 | Gene: | Rcc2 / 108911 | MGIID: | 1919784 | Length: | 520 | Species: | Mus musculus |
Alignment Length: | 222 | Identity: | 57/222 - (25%) |
---|---|---|---|
Similarity: | 93/222 - (41%) | Gaps: | 55/222 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 175 RVKQLQCGH--EHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWH 237
Fly 238 SAAISAFGDLYTWGLNCSGQLGL-----RVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDD 297
Fly 298 CAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALE----------GITMN 352
Fly 353 PTVD------------DVLCGPWSTLL 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 57/222 (26%) |
RCC1_2 | 176..205 | CDD:290274 | 7/30 (23%) | ||
RCC1 | 192..241 | CDD:278826 | 17/48 (35%) | ||
RCC1_2 | 228..257 | CDD:290274 | 8/28 (29%) | ||
Rcc2 | NP_776292.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..78 | ||
RCC1 1 | 101..163 | 4/15 (27%) | |||
ATS1 | 129..479 | CDD:227511 | 57/222 (26%) | ||
RCC1 2 | 166..217 | 18/50 (36%) | |||
RCC1 3 | 219..269 | 15/74 (20%) | |||
RCC1 4 | 271..345 | 19/73 (26%) | |||
Required for interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q9P258 | 316..323 | 2/6 (33%) | |||
RCC1 5 | 346..399 | ||||
RCC1 6 | 401..445 | ||||
RCC1 7 | 446..499 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |