DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcc2

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_776292.1 Gene:Rcc2 / 108911 MGIID:1919784 Length:520 Species:Mus musculus


Alignment Length:222 Identity:57/222 - (25%)
Similarity:93/222 - (41%) Gaps:55/222 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 RVKQLQCGH--EHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIKITQIAAGGWH 237
            ||:.:..|.  .|::|:...|.:::||...:||||..:.:..|.|:|:|||:...|...|.|..|
Mouse   147 RVRTVVSGSCAAHSLLITTEGKLWSWGRNEKGQLGHGDTKRVEAPRLIEALSHEAIVLAACGRNH 211

  Fly   238 SAAISAFGDLYTWGLNCSGQLGL-----RVMKPGGVLKEPTVFPLPQLQDLPECACSQSGESNDD 297
            :.|::..|.::.:|.|..|||||     .|..|..::...        |.:.:.||         
Mouse   212 TLALTDTGSVFAFGENKMGQLGLGNQTDAVPSPAQIMYNG--------QPITKMAC--------- 259

  Fly   298 CAPLRVFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQALE----------GITMN 352
                    |:..::|:...|.|:..|..::||||.. .|..::...|.:|          .|.:.
Mouse   260 --------GAEFSMLMDCKGNLYSFGCPEYGQLGHN-SDGKFIARAQRIEYDCELVPRRVAIFIE 315

  Fly   353 PTVD------------DVLCGPWSTLL 367
            .|.|            ||.||...||:
Mouse   316 KTKDGQILPVPNVVVRDVACGANHTLV 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 57/222 (26%)
RCC1_2 176..205 CDD:290274 7/30 (23%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 8/28 (29%)
Rcc2NP_776292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..78
RCC1 1 101..163 4/15 (27%)
ATS1 129..479 CDD:227511 57/222 (26%)
RCC1 2 166..217 18/50 (36%)
RCC1 3 219..269 15/74 (20%)
RCC1 4 271..345 19/73 (26%)
Required for interaction with RAC1. /evidence=ECO:0000250|UniProtKB:Q9P258 316..323 2/6 (33%)
RCC1 5 346..399
RCC1 6 401..445
RCC1 7 446..499
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.