| Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001074751.1 | Gene: | Ibtk / 108837 | MGIID: | 1918677 | Length: | 1352 | Species: | Mus musculus |
| Alignment Length: | 256 | Identity: | 73/256 - (28%) |
|---|---|---|---|
| Similarity: | 112/256 - (43%) | Gaps: | 54/256 - (21%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 146 GSHINVAI--SSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL 208
Fly 209 AELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPT 273
Fly 274 VFPLP-QLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRR--CGRLWVSGWCKHGQLG---- 331
Fly 332 ----------RQLQDLSYVDAFQAL----EGITMNPT-------VDDVLCGPWST-LLHLK 370 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 73/256 (29%) |
| RCC1_2 | 176..205 | CDD:290274 | 11/28 (39%) | ||
| RCC1 | 192..241 | CDD:278826 | 17/48 (35%) | ||
| RCC1_2 | 228..257 | CDD:290274 | 10/28 (36%) | ||
| Ibtk | NP_001074751.1 | Ank_2 | 25..116 | CDD:289560 | |
| ANK | <47..135 | CDD:238125 | |||
| ANK repeat | 51..82 | CDD:293786 | |||
| ANK 1 | 51..80 | ||||
| ANK repeat | 84..116 | CDD:293786 | |||
| ANK 2 | 85..114 | ||||
| RCC1 1 | 141..194 | 14/46 (30%) | |||
| RCC1 | 143..192 | CDD:278826 | 13/44 (30%) | ||
| RCC1 2 | 195..246 | 17/50 (34%) | |||
| RCC1_2 | 232..260 | CDD:290274 | 10/27 (37%) | ||
| RCC1 | 247..299 | CDD:278826 | 20/69 (29%) | ||
| RCC1 3 | 248..301 | 21/70 (30%) | |||
| BTB | 562..>643 | CDD:279045 | |||
| BTB | 566..>643 | CDD:197585 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 692..716 | ||||
| BTB | 762..868 | CDD:279045 | |||
| BTB | 770..872 | CDD:197585 | |||
| SPOP_C_like | 872..>919 | CDD:269810 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 976..1002 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1032..1094 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||