Sequence 1: | NP_650996.1 | Gene: | CG6678 / 42581 | FlyBaseID: | FBgn0038917 | Length: | 373 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001074751.1 | Gene: | Ibtk / 108837 | MGIID: | 1918677 | Length: | 1352 | Species: | Mus musculus |
Alignment Length: | 256 | Identity: | 73/256 - (28%) |
---|---|---|---|
Similarity: | 112/256 - (43%) | Gaps: | 54/256 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 146 GSHINVAI--SSENCVYSIPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGL 208
Fly 209 AELRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPT 273
Fly 274 VFPLP-QLQDLPECACSQSGESNDDCAPLRVFAGSRHTLLIRR--CGRLWVSGWCKHGQLG---- 331
Fly 332 ----------RQLQDLSYVDAFQAL----EGITMNPT-------VDDVLCGPWST-LLHLK 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG6678 | NP_650996.1 | ATS1 | <78..371 | CDD:227511 | 73/256 (29%) |
RCC1_2 | 176..205 | CDD:290274 | 11/28 (39%) | ||
RCC1 | 192..241 | CDD:278826 | 17/48 (35%) | ||
RCC1_2 | 228..257 | CDD:290274 | 10/28 (36%) | ||
Ibtk | NP_001074751.1 | Ank_2 | 25..116 | CDD:289560 | |
ANK | <47..135 | CDD:238125 | |||
ANK repeat | 51..82 | CDD:293786 | |||
ANK 1 | 51..80 | ||||
ANK repeat | 84..116 | CDD:293786 | |||
ANK 2 | 85..114 | ||||
RCC1 1 | 141..194 | 14/46 (30%) | |||
RCC1 | 143..192 | CDD:278826 | 13/44 (30%) | ||
RCC1 2 | 195..246 | 17/50 (34%) | |||
RCC1_2 | 232..260 | CDD:290274 | 10/27 (37%) | ||
RCC1 | 247..299 | CDD:278826 | 20/69 (29%) | ||
RCC1 3 | 248..301 | 21/70 (30%) | |||
BTB | 562..>643 | CDD:279045 | |||
BTB | 566..>643 | CDD:197585 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 692..716 | ||||
BTB | 762..868 | CDD:279045 | |||
BTB | 770..872 | CDD:197585 | |||
SPOP_C_like | 872..>919 | CDD:269810 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 976..1002 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1032..1094 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5184 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |