DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and ibtk

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_031757996.1 Gene:ibtk / 100490098 XenbaseID:XB-GENE-5755983 Length:1337 Species:Xenopus tropicalis


Alignment Length:185 Identity:55/185 - (29%)
Similarity:80/185 - (43%) Gaps:42/185 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQLLEALAGIK 227
            |..|..|......:||:.....|:|.|:..|.|:|.|:|..|:||..:......|:|:|.|:...
 Frog   167 PELLETFPRSGVYIKQVVLCKFHSVFLSQKGQVYTCGHGQGGRLGHGDELTCLVPRLVEGLSTHP 231

  Fly   228 ITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPE--CACSQ 290
            ..|:||...|:..:|..|.:||:|||...|||::              |.|...::|:  .|.:.
 Frog   232 CAQVAAAKDHTVVLSEDGYVYTFGLNTFHQLGIQ--------------PPPPNSNVPKQVQAKTM 282

  Fly   291 SGESNDDCAPLRVFAGSRHTLLIRRCGRLWVSGWCKH---------GQLGRQLQD 336
            .|::     .|.|.||..||:|           |.|.         |||| .|||
 Frog   283 KGKT-----VLGVAAGRFHTVL-----------WTKDAVYTVGLNGGQLG-YLQD 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 55/185 (30%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 16/48 (33%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
ibtkXP_031757996.1 Ank_2 25..117 CDD:403870
ANK repeat 85..117 CDD:293786
ATS1 <139..363 CDD:227511 55/185 (30%)
BTB1_POZ_IBtk 537..645 CDD:349610
BTB2_POZ_IBtk 753..865 CDD:349611
BACK_IBtk 861..920 CDD:350575
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.