DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and herc3

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_002938676.3 Gene:herc3 / 100488790 XenbaseID:XB-GENE-968537 Length:1050 Species:Xenopus tropicalis


Alignment Length:358 Identity:95/358 - (26%)
Similarity:150/358 - (41%) Gaps:91/358 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 WRYAALA-FGRKLCLRGLLDDGPNEC-VTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAE 108
            |.::... .|.....:|.:.| |..| .:|.|.  ::.:|....|.|.||:.||:|......:.:
 Frog     4 WGHSTFGQLGNGHSFQGSVSD-PCVCRFSLAAC--VKEVACGGKHTLFLLEDGQVYSCGWNGEGQ 65

  Fly   109 LVAVRLEAAPRSNSGTKRSIFGAAKAPSSPI---------IEHIACGSHINVAISSENCVYS--- 161
            |        ...:.||            .|:         |.|||||...|:|:|.:..:||   
 Frog    66 L--------GHDHEGT------------DPVQVTTLTEEHITHIACGQSHNLALSYQGQLYSWGS 110

  Fly   162 ----------------IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAE 210
                            ||..:.:.:::  :::|:.||::|.:.|..:|.:||||..|.|||||..
 Frog   111 GNDGQLGHATVEHSSRIPRIIKKLNQQ--KIQQVSCGNDHCMALGDDGQLFTWGQNLHGQLGLGN 173

  Fly   211 -LRVEETPQLLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTV 274
             ...:.:||.:::|.||.:.|:.|||.||.|:|..|.::.||.|.:|||||...|          
 Frog   174 GFLSQSSPQRVKSLEGIPLAQVTAGGSHSFALSLSGAVFGWGNNSAGQLGLNDEK---------- 228

  Fly   275 FPLPQLQDLPECACSQSGESNDDCAPLR------VFAGSRHTLLIRRCGRLWVSGWCKHGQLGRQ 333
                    :.|..|        ...|||      :..|..||.::.:.|.|:..|....||||..
 Frog   229 --------VRETPC--------HVKPLRTHKVIYISCGEEHTAILTKAGGLFTFGAGGSGQLGHD 277

  Fly   334 LQDLSYVDAFQALEGITMNPTVDDVLCGPWSTL 366
            ..: :.::..:.||  .|...|..:.||...||
 Frog   278 SLN-NEINPRRVLE--LMGSEVSQIACGRQHTL 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 87/324 (27%)
RCC1_2 176..205 CDD:290274 11/28 (39%)
RCC1 192..241 CDD:278826 22/49 (45%)
RCC1_2 228..257 CDD:290274 12/28 (43%)
herc3XP_002938676.3 RCC1 3..49 CDD:395335 11/47 (23%)
ATS1 44..353 CDD:227511 86/315 (27%)
HECTc 702..1048 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.