DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and als2b

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_009300450.1 Gene:als2b / 100318899 ZFINID:ZDB-GENE-080929-1 Length:1706 Species:Danio rerio


Alignment Length:273 Identity:71/273 - (26%)
Similarity:111/273 - (40%) Gaps:67/273 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RVQPKLQAELVAVRLEAAPRSNSGTKRSIFGAAKAPSSPIIEHIAC-------GSHINVAISSEN 157
            ||:.:|:.|          .|..|.|.|..|..:...:.:...::.       .:...|..||.|
Zfish   472 RVEERLRLE----------ESMQGKKSSSLGDIREEEAELSRRLSLPGLLSQDNAESEVKASSSN 526

  Fly   158 CVYSI-PSCLHQFSERQFRVKQLQCG---HEHAVLLNANGDVFTWGNGLRGQLGLAELRVEETPQ 218
            ....: |..|.:.|..:.|...|..|   ...|.|.:...:|::||.|..||||..:|.....|.
Zfish   527 TTTEVSPRLLRRTSRPRMRAVPLASGGIPETDAHLPSLQTEVWSWGQGQDGQLGHGDLLPRLQPD 591

  Fly   219 LLEALAGIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFP-LPQLQD 282
            .:::|.|.::.::|||..||.|::|...:::||.|.||||        |.::.||.|| |.:|.|
Zfish   592 CVKSLNGKEVLKVAAGAHHSLALTAQSQVFSWGCNTSGQL--------GHMESPTTFPQLTKLSD 648

  Fly   283 LPECACSQSGESNDDCAPLRVF---AGSRHTLLIRRCGRLWVSGWCKHGQLGRQLQDLSYVDAFQ 344
                             .:||:   ||.:||||:       ..|.|        :|.:.|....|
Zfish   649 -----------------GIRVWDIGAGLQHTLLL-------ADGDC--------IQPILYYSGQQ 681

  Fly   345 ALEGITMNPTVDD 357
            ..|  ...||.::
Zfish   682 VKE--VPEPTEEE 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 71/273 (26%)
RCC1_2 176..205 CDD:290274 8/31 (26%)
RCC1 192..241 CDD:278826 17/48 (35%)
RCC1_2 228..257 CDD:290274 11/28 (39%)
als2bXP_009300450.1 RCC1_2 88..117 CDD:290274
RCC1 104..160 CDD:278826
RCC1 165..211 CDD:278826
RCC1 567..614 CDD:278826 17/46 (37%)
RCC1 619..665 CDD:278826 22/70 (31%)
PH_alsin 952..1065 CDD:241423
COG4642 1085..1290 CDD:226989
MORN 1104..1124 CDD:280628
MORN 1153..1173 CDD:197832
VPS9 1603..1702 CDD:280383
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.