DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and Rcc1

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001184011.1 Gene:Rcc1 / 100088 MGIID:1913989 Length:434 Species:Mus musculus


Alignment Length:352 Identity:79/352 - (22%)
Similarity:129/352 - (36%) Gaps:83/352 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AFGQHECVSGDVDCAAGFSELNAPVSTQNQCTISIGWRY-AALAFGRKLCLRGLLDDGPNEC--- 70
            |.|:...|.|. :...|..||...|     ..:|.|..: |||....::.|.|...|.....   
Mouse   111 ALGRDTSVEGS-EMVPGKVELQEKV-----VQVSAGDSHTAALTEDGRVFLWGSFRDNNGVIGLL 169

  Fly    71 ---------VTLEATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPR--SNSGT 124
                     |.::....:..:|:.:.|.::|...|.||.:....|.:|..|     |.  :|.|.
Mouse   170 EPMKKSMVPVQVQLDAPVVKVASGNDHLVMLTNDGDLYTLGCGEQGQLGRV-----PELFANRGG 229

  Fly   125 KRSIFGAAKAPSSPII-----------EHIACGSHINVAISSENCVYS----------------- 161
            ::.: |....|...::           :...||::...|||.|..||.                 
Mouse   230 RQGL-GRLLVPRCVLLKSRGTRGRVRFQDAFCGAYFTFAISREGHVYGFGLSNYHQLGTPGTGSC 293

  Fly   162 -IPSCLHQFSERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLAELRVEET-PQLLEALA 224
             ||..|..|............|..|.|.:::.|..::.|....|:|||.|...|:: |.|:..|.
Mouse   294 FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLP 358

  Fly   225 GIKITQIAAGGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACS 289
              .::.:|.|.....|:|..|.::.||:..:.|||..                   ||  |.|.|
Mouse   359 --VVSSVACGASVGYAVSKDGRVFAWGMGTNYQLGTG-------------------QD--EDAWS 400

  Fly   290 ---QSGESNDDCAPLRVFAGSRHTLLI 313
               .:|:..::...|.|.:|.:||:|:
Mouse   401 PVEMTGKQLENRVVLTVSSGGQHTVLL 427

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 62/271 (23%)
RCC1_2 176..205 CDD:290274 5/28 (18%)
RCC1 192..241 CDD:278826 13/49 (27%)
RCC1_2 228..257 CDD:290274 7/28 (25%)
Rcc1NP_001184011.1 RCC1 48..95 CDD:278826
RCC1 98..147 CDD:278826 11/41 (27%)
RCC1 150..200 CDD:278826 6/49 (12%)
RCC1_2 187..216 CDD:290274 7/28 (25%)
RCC1 203..268 CDD:278826 13/70 (19%)
RCC1 271..322 CDD:278826 10/50 (20%)
RCC1 325..368 CDD:278826 13/44 (30%)
RCC1 376..427 CDD:278826 17/71 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5184
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.