DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6678 and herc4

DIOPT Version :9

Sequence 1:NP_650996.1 Gene:CG6678 / 42581 FlyBaseID:FBgn0038917 Length:373 Species:Drosophila melanogaster
Sequence 2:XP_031760534.1 Gene:herc4 / 100036667 XenbaseID:XB-GENE-962981 Length:1057 Species:Xenopus tropicalis


Alignment Length:363 Identity:90/363 - (24%)
Similarity:140/363 - (38%) Gaps:94/363 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 GPNECVTLE-------ATGNIRALAAADSHCLVLLQSGQLYRVQPKLQAELVAVRLEAAPRSNSG 123
            |.:|.|.||       ...|:|.:.....|.:.:|..|.:|........:|        ....|.
 Frog    16 GIDEEVVLEPRRCDFFINKNVRDVGCGSRHTVFVLDDGTVYTCGCNDLGQL--------GHDKSR 72

  Fly   124 TKRSIFGAAKAPSSPIIEHIACGSHINVAISSENCVYS-------------------IPSCLHQF 169
            .|....||..|   .||..::||....:|::.:..|:|                   :|..:...
 Frog    73 RKPEQVGALDA---QIIVAVSCGEAHTLALNDKGQVFSWGHAVYGQIGLSTAEEYIRVPRNIKSL 134

  Fly   170 SERQFRVKQLQCGHEHAVLLNANGDVFTWGNGLRGQLGLA-ELRVEETPQLLEALAGIKITQIAA 233
            |:.|  :.|:.|||.|::.|:.:.|:|:||....|||||. |::.|..|:.:::|:||....|||
 Frog   135 SDVQ--IVQVACGHHHSLALSKDSDIFSWGQNQYGQLGLGLEIKKECAPRHIKSLSGIPFAHIAA 197

  Fly   234 GGWHSAAISAFGDLYTWGLNCSGQLGLRVMKPGGVLKEPTVFPLPQLQDLPECACSQS------- 291
            ||.||.|::..|.::.||.|..|||||.......|   |.:....:.|.:....|.:.       
 Frog   198 GGGHSFALTISGAIFGWGRNKFGQLGLTDETDRNV---PALLKSLRSQKIIHICCGEDHTAALTK 259

  Fly   292 -----------------GESNDDCAPLRVF-----------AGSRHTL-LIRRCGRLWVSGWCKH 327
                             ..:|.:..|.:||           .|.:||| .:...||::..|...:
 Frog   260 EGGVFTFGAGGYGQLGHNSTNHEVNPRKVFELMGSIVTQIACGRQHTLAFVPSSGRIYSFGLGGN 324

  Fly   328 GQLGRQLQDLSYVDAFQALEGITMNPTVDDVLCGPWST 365
            ||||               .|.|:|......:.|.|.|
 Frog   325 GQLG---------------TGSTINRKSPFTVKGNWLT 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6678NP_650996.1 ATS1 <78..371 CDD:227511 85/344 (25%)
RCC1_2 176..205 CDD:290274 10/28 (36%)
RCC1 192..241 CDD:278826 22/49 (45%)
RCC1_2 228..257 CDD:290274 12/28 (43%)
herc4XP_031760534.1 ATS1 2..353 CDD:227511 90/363 (25%)
HECTc 709..1055 CDD:238033
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062377at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.