DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dnd and CIN4

DIOPT Version :9

Sequence 1:NP_650995.1 Gene:dnd / 42580 FlyBaseID:FBgn0038916 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_013858.1 Gene:CIN4 / 855169 SGDID:S000004746 Length:191 Species:Saccharomyces cerevisiae


Alignment Length:181 Identity:66/181 - (36%)
Similarity:102/181 - (56%) Gaps:20/181 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGLLSLLR--KLRPNPEKEARILLLGLDNAGKTTILKQLASEDITT---VTPTAGFNIKSVAADG 60
            |||||::|  |||   :||.|.|:|||||:||:||:.:|..:|...   :.||.||.|.|:....
Yeast     1 MGLLSIIRKQKLR---DKEIRCLILGLDNSGKSTIVNKLLPKDEQNNDGIMPTVGFQIHSLMIKD 62

  Fly    61 FKLNVWDIGGQWKIRPYWKNYFANTDVLIYVIDCTDRTRLPEAGSELFEMLM--DNRL-KQVPVL 122
            ..:::||||||..:||:|.|||..|..:|:.||.:...|..|...||.|::.  :||: .:..|:
Yeast    63 VTISLWDIGGQRTLRPFWDNYFDKTQAMIWCIDVSLSMRFDETLQELKELINRDENRIGYECAVI 127

  Fly   123 IFANKQDMPDAMSAAEVAEKMSLVQLQGRTW-------EIKACTAVDGTGL 166
            :..||.|:.:..|  |:..:..||:.:.:..       |:..|:.|.|.|:
Yeast   128 VVLNKIDLVEDKS--ELHRRCLLVESELKCLFKPDIRIELVKCSGVTGEGI 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dndNP_650995.1 Arl3 3..176 CDD:206721 64/179 (36%)
CIN4NP_013858.1 P-loop_NTPase 3..187 CDD:422963 64/179 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.